|
Ten New Peptides - July 24, 2007
Today AnaSpec introduced ten (10) new peptides for drug discovery research.
HIV Nef (68–76) - Cat# 61673
This HIV nef peptide 68 to 76 amino acids was identified in HIV-infected individuals. It is a B7 restricted epitope and a high affinity HLA binder.
Sequence: FPVTPQVPL
Substance P (1-6); amide - Cat# 61690
Substance P (SP) is an important neuropeptide that has been implicated in several physiological processes. This peptide is 1 to 6 amino acid fragment of SP. This peptide is one of the products of SP hydrolysis by kidney endopeptidase.
Sequence: RPKPQQ-NH2
Substance P (1-7); amide - Cat# 61691
Substance P (SP) is an important neuropeptide that has been implicated in several physiological processes. This bioactive N-terminal fragment 1 to 7 amino acid of substance P is generated by substance P endopeptidase; a predominantly cytosolic enzyme.
Sequence: RPKPQQF-NH2
Substance P (5-11); amide - Cat# 61692
Substance P (SP) is an important neuropeptide that has been implicated in several physiological processes. This is fragment 5 to 11 amino acids of substance P.
Sequence: QQFFGLM-NH2
Substance P (8-11) - Cat# 61694
Substance P (SP) is an important neuropeptide that has been implicated in several physiological processes. This SP fragment 8 to 11 amino acids was used in the healing of corneal epithelial wounds study. The combination of FGLM-NH2 and IGF-1 promotes corneal epithelial wound healing in diabetic rats; suggesting that this kind of treatment might prove effective in humans with diabetic keratopathy. Administration of eyedrops containing both FGLM–NH2 and SSSR is effective for the treatment of persistent epithelial defects in individuals with neurotrophic keratopathy.
Sequence: FGLM-NH2
Substance P (9-11) - Cat# 61695
Substance P (SP) is an important neuropeptide that has been implicated in several physiological processes. This is a SP peptide fragment 9 to 11 amino acid. It is also a common C-terminal tachykinin motif.
Sequence: GLM-NH2
Influenza Virus A/Aichi/2/68 Haemagglutinin HA1 (195-209); X-31 - Cat# 61696
This is fragment 195 to 209 amino acid from the early Hong Kong influenza virus A/Aichi/2/68 (X-31). The complete amino acid sequence (328 residues) of variant-A/Aichi/68 HA`1 was compared to A/Memphis/72 haemagglutinins; and the study has revealed several differences in structure. The monosaccharide compositions of the individual carbohydrate units on variant-A/Aichi/68 haemagglutinin differ from those of the corresponding units in variant-A/Memphis/72 haemagglutinin.
Sequence: YVQASGRVTVSTRRS
LL-37; reverse sequence - Cat# 62208
The reverse sequence of LL-37 (see Cat# 61302).
Sequence: SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
Peptide Substrate for Rennin 520 Assay kit - Cat# 61872
This FRET peptide is a specific substrate for renin; the aspartyl protease that cleaves the angiotensinogen to yield angiotensin I that is converted to the angiotensin II. The renin-angiotensin system is a coordinated hormonal cascade in the control of cardiovascular; renal; and adrenal function that governs body fluid and electrolyte balance; as well as arterial pressure. Since an overactive renin-angiotensin system leads to hypertension; renin is an attractive target for the treatment of this disease. This renin peptide substrate may be used for screening of renin inhibitors and renin activity. In the FRET peptide the fluorescence of 5-FAM is quenched by QXL™520. Upon cleavage into two separate fragments by renin; the fluorescence of 5-FAM is recovered; and can be monitored at excitation/emission = 490/520 nm to detect the activity of enzyme renin. This substrate is employed in the SensoLyte™ 520 Renin Assay Kit *Fluorimetric*; cat # 72040.
Sequence:
RL-37 - Cat# 61313
RL-37; a 37-residue anti-microbial peptide of the cathelicidin family; is expressed in the bone marrow of rhesus monkey. In contrast to human LL-37; which has 5 acidic residues; RL-37 has only 2 and is considerably more potent against staphylococci than LL-37.
Sequence: RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS
|