|
Thirty-Six New Peptides - August 1, 2007
This week AnaSpec introduced thirty-six (36) new peptides for drug discovery research.
Protease-Activated Receptor-4; PAR-4 Agonist; amide; human - Cat# 60779
Sequence: GYPGQV-NH2
Amyloid Precursor Protein (APP) (667-676); Swedish mutation - Cat# 62060
This Swedish mutation fragment of the amyloid precursor protein amino acids 667 to 676 is cleaved by BACE; BACE2 with an extremely high activity; and by the enzyme thimet oligopeptidase (TOP) with moderate activity.
Sequence: [N670; L671]-SEVNLDAEFR
Colivelin - Cat# 61930
This hybrid peptide named colivelin was synthesized to potentiate the neuroprotective effect of humanin (HN). Colivelin is composed of Activity-Dependent Neurotrophic Factor (ADNF) C-terminally fused to AGA-(C8R) HNG17; a potent HN derivative. Colivelin completely suppresses cell death induced by overexpressed Familial Alzheimer's disease (FAD)-causative genes and beta-amyloid (1-43). Intraperitoneally administered colivelin suppresses memory impairment and might serve as a novel drug candidate for treatment of Alzheimer's disease.
Sequence: SALLRSIPAPAGASRLLLLTGEIDLP
AGA-(C8R) HNG17; Humanin derivative - Cat# 61928
This peptide is a potent humanin (HN) derivative. It completely suppresses neuronal cell death by Alzheimer's disease-relevant insults.
Sequence: PAGASRLLLLTGEIDLP
[Gln9]-beta-Amyloid (1-40) - Cat# 61948-05
This is 1 to 40 amino acids beta-amyloid peptide fragment with a single amino acid substitution of Gly to Gln at position 9.
Sequence: DAEFRHDSQYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
[D-Ser14]- Humanin (HN) - Cat# 61927
This is a humanin (HN) peptide analog where Ser14 is substituted with a D-isomer Ser. The D-isomerization at this position increases the HN neuronal rescue function from Alzheimer's disease-relevant insults by two to three orders of magnitude. Please see the related peptide; Humanin; cat # 60886.
Sequence: MAPRGFSCLLLLTsEIDLPVKRRA
Tat-NR2Bct - Cat# 62042
This is the membrane-permeable postsynaptic density (PSD)-95-binding (decoy) peptide Tat-NR2Bct. It can transduce into neurons in cell culture.
Sequence: YGRKKRRQRRRKLSSIESDV
TAT (47-57)-Lys(TAMRA) - Cat# 62056
This peptide is an eleven amino acid cell permeable human immunodeficiency virus transactivating regulatory protein (TAT) domain; cell permeable; labeled with TAMRA; Abs/Em=544/572 nm.
Sequence: YGRKKRRQRRR-K(TAMRA)
Galanin (1-13)/ Galanin Like Peptide (GALP) (9-21); common - Cat# 61846
This peptide is a galanin 1 to 13 amino acids fragment. Galanin is a neuropeptide found in the central and peripheral nervous systems; it displays several important physiological activities. This peptide was originally isolated from the porcine hypothalamus after the discovery of its agonistic activity for galanin receptor subtype GALR2. This amino acid sequence has been determined in pigs; humans; rats; and macaque monkeys; and is conserved in all of these species. It is identical to that of galanin like peptide (GALP) 9 to 21 amino acids.
Sequence: GWTLNSAGYLLGP
Gastrin derived peptide - Cat# 61745
This is a Gastrin derived peptide; the mediator of secretion of proximal nutrient-induced proglucagon derived peptide from the distal gut.
Sequence: GPWLEEEEEAYGWMDFK-NH2
STT Gelatinase Inhibitor modification; negative control - Cat# 62053
This control peptide; STT negative control; does not reverse renal vasodilation and hyperfiltration in relaxin-treated rodents; while the specific peptide inhibitor of the gelatinases MMP-2 and -9; cyclic CTT completely reverses these functions. Selective inhibition of endogenous MMP-2 with the native CTT peptide caused vasorelaxation; while this STT gelatinase inhibitor negative control; an inactive CTT analogue; did not dilate the arteries.
Sequence: STTHWGFTLS
CTT; Gelatinase Inhibitor - Cat# 62054
This cyclic CTT Gelatinase Inhibitor peptide is an inhibitor for matrix metalloproteinases (MMP)-2 and MMP-9. It is also called type IV collagenase or gelatinase. Gelatinases are potential targets of therapeutic intervention in cancer; and inhibitors of these enzymes can prevent tumor progression. Cyclic CTT inhibits the migration of human endothelial cells and tumor cells. It prevents tumor growth and invasion. Inhibitors; complexed with their target proteinases; can be taken up into cells by endocytosis; and CTT added to liposomes enhances their uptake by tumor cells; thus providing possibility of liposomal delivery of chemotherapeutic agents. MMP-2 inhibition with cyclic CTT is also important in hypoxia studies.
Sequence: CTTHWGFTLC (Disulfide Bridge: 1-10)
PB1F (262–70) Influenza Gene Product - Cat# 62036
This peptide is derived from a conserved 87-residue protein PB1-F2. The peptide has unusual features compared with other influenza gene products. These include its variable expression in individual infected cells; rapid proteasome-dependent degradation; and mitochondrial localization. PB1F2 peptide amino acid residues 62 to 70 is an H-2Db–restricted peptide epitope. It was widely used to study influenza A virus-specific CD8+ T cell responses.
Sequence: LSLRNPILV
Yellow Fever Virus Envelope Protein E1 - Cat# 62026
This peptide is a fragment of the French strain neurotropic virus envelope protein E1 of yellow fever dengue (DEN) virus. DEN virus is a mosquito born flavivirus.
Sequence: IGITDRDFI
Dengue 1 Fragment; VGIGNRDFV - Cat# 62032
This is the fragment of a Dengue virus (DEN) that causes a spectrum of clinical disease; ranging from the self-limited dengue fever; usually accompanied by arthrolgia; myalgia; and headache; to dengue hemorrhagic fever (DHF) marked by thrombocytopenia; hemorrhagic manifestations; increased vascular permeability (plasma leakage); to dengue shock syndrome (DSS); which when untreated may lead to death.
Sequence: VGIGNRDFV
Dengue 2 Virus Fragment; IGISNRDFV - Cat# 62033
This peptide is a fragment of the Dengue (DEN) virus. DEN virus is a mosquito born flavivirus.
Sequence: IGISNRDFV
Generic Protein Kinase Substrate - Cat# 61875
This peptide is an excellent substrate for a large number of serine/threonine kinases. It contains the seven residue epitope LSFAEPG that includes the phosphorylation site at serine. Many protein kinases may be screened using this common peptide substrate.
Sequence: RARTLSFAEPG
Dictyostelium Myosin II Heavy Chain; MH-1 (2020-2035) - Cat# 62034
This peptide is a fragment from Dictyostelium myosin II heavy chain; the substrate for the Dictyostelium myosin II heavy-chain kinase A (MHCK A). Threonine 2029 is one of the major phosphorylation sites of MHCK A. Myosin II plays an important role in a wide variety of contractile events in eukaryotic cells by supporting ATP-dependent movement of actin filaments. Myosin heavy chain kinase A participates in the regulation of cytoskeletal myosin assembly in Dictyostelium.
Sequence: RKKFGESEKTKTKEFL
Neuropeptide W-23 (NPW23); rat - Cat# 61853
This 23-amino acid rat neuropeptide W 23 (NPW23) is the endogenous ligand for orphan G-protein-coupled receptors GPR7 and GPR8 expressed in the central nervous system. NPW is distributed both peripherally and centrally in the rat. This peptide plays modulatory role in the control of food intake; administration of NPW23 in rat increases food intake. Immunoreactive NPW23 cells were found in several nuclei of the hypothalamus; including the paraventricular nucleus (PVN); supraoptic nucleus; accessory neurosecretory nuclei; dorsal and lateral hypothalamic (LH) areas; perifornical nucleus; arcuate nucleus; and anterior and posterior pituitary.
Sequence: WYKHVASPRYHTVGRASGLLMGL
Dok-5 (130-145) - Cat# 61895
This peptide is a fragment 130 to 145 amino acids of the Dok-5; a 4/5 subclass of the p62 Dok family. The expression of Dok-5 has been shown to promote receptor tyrosine kinase (Ret)-mediated neurite outgrowth in vitro. Dok family members are modular docking proteins consisting of an N-terminal pleckstrin homology (PH) domain; a central PTB domain; and a variable C-terminal region.
Sequence: GVEREQSERFNVYLMP
Pannexin-1 (Panx1); Mimetic Blocking Peptide - Cat# 61911
This is a Pannexin-1 (Panx1) mimetic blocking peptide. Pannexin-1 is a recently identified membrane protein that can form gap junction-like connections allowing intercellular passage of dyes when overexpressed in two adjacent oocytes or mammalian epithelial cell lines. Blockade of pannexin-1 in macrophage endogenously expressing the ATP-gated P2X7 receptor (P2X7R) blocks the initial dye uptake; but not the ionic current; and also blocks processing and release of interleukin-1? (IL-1?) in response to P2X7R activation.
Sequence: WRQAAFVDSY
Obestatin (11-23); rat; mouse - Cat# 62040
This peptide is a fragment of the rat and mouse obestatin peptide; amino acids 11 to 23. Obestatin peptide; derived from the ghrelin gene; suppresses food intake; inhibits jejunal contraction; and decreases body-weight gain.
Sequence: LSGAQYQQHGRAL
[Des Ala20; Gln34] Dermaseptin - Cat# 61910
This is a C-terminally truncated fragment of the dermaseptin peptide. Shortening the dermaseptin peptide at the C-terminus abolishes the recognition of the peptide by anti-dermaseptin antibodies. This peptide slightly cross-reacts with anti-dermaseptin I antibody.
Sequence: ALWKTMLKKGTMALHAGK
Sialokinin-1 - Cat# 61935
This invertebrate tachykinin like peptide Sialokinin-1 sharing the F-X-GLM-NH2 vertebrate consensus sequence was purified from salivary gland of Aedes aegypti (Yellowfever mosquito) and was shown to have potent vasodilatory activity in mammals. Sialokinin-1 has been shown to mature from the precursor through unusual posttranscriptional modification.
Sequence: NTGDKFYGLM-NH2
[Cys(Acm)33]-Endostatin (6-49) - Cat# 61861-05
This 6 to 49 amino acids peptide fragment of endostatin can be used as an angiogenesis inhibitor; the substitute for the full length endostatin in therapeutic applications for cancer; rheumatoid arthritis; and retinopathies.
Sequence: FQPVLHLVALNSPLSGGMRGIRGADFQ-C(Acm)-FQQARAVGLAGTFRAF
NES p120ctn - Cat# 61878
This is the nuclear export signal (NES) peptide corresponding to the part of exon B-encoded p120ctn. NES is comprised of stretches of hydrophobic residues involved in the nucleocytoplasmic shuttling of heterogeneous nuclear ribonucleoproteins and proteins. The NES consensus sequence is LX(2-3)LX(2-3)LXL.
Sequence: CSLEEELDVLVLDDEGG
NES Topoisomerase II alpha (1054-1066) - Cat# 61896
This peptide; a nuclear export signal (NES) for topoisomerase II alpha 1054 to 1066 amino acids; supports export of topoisomerase II alpha from the nucleus to the cytoplasm. Proteins targeted for receptor-mediated transport across the nuclear pore complexes must either contain a nuclear localization signal (NLS) or a nuclear export signal (NES).
Sequence: FILEKIDGKIIIE
NES Nmd3p (491-500) - Cat# 61889
This peptide is a C terminal fragment of Nmd3p; a highly conserved protein; predicted to form an amphipathic helix with isoleucine and leucine predominantly on one face. Such a structure is characteristic of a leucine-rich NES; the ligand for the export receptor Crm1p.
Sequence: INIDELLDEL
NES Adenoviral E1A - Cat# 61885
This peptide is a novel CRM1-dependent nuclear export signal (NES) in adenoviral E1A protein that is required for efficient viral replication. Adenoviral E1A is a versatile protein that can re-program host cells for efficient viral replication. Mutation in the C-terminal nuclear location signal changes the localization of the E1A protein from a nuclear to pancellular localization.
Sequence: VMLAVQEGIDL
Transglutaminase Substrate; biotinylated - Cat# 62051
This peptide is a transglutaminase substrate. Transglutaminases are calcium-dependent enzymes that catalyze a post-translational modification of proteins through the formation of ?-(?-glutamyl) lysine bonds. This peptide may be used as acyl donor probe in the transglutaminase assays.
Sequence: Biotin-TVQQEL
Piscicolin 126 - Cat# 61916-05
Bacteriocin pisciolin 126 is a peptide produced by the lactic acid bacterium Carnobacterium piscicola JG126. It strongly inhibits growth of several gram-positive bacteria; but has no effect on yeasts and gram-negative bacteria. Bactericidal activity is not destroyed by exposure to elevated temperatures at low pH values; however it is lost at high pH; especially when combined with an elevated temperature.
Sequence: KYYGNGVSCNKNGCTVDWSKAIGIIGNNAAANLTTGGAAGWNKG (Disulfide bridge: 9-14)
Dermaseptin - Cat# 61913-05
This 34-residue anionic amphiphatic antimicrobial peptide named dermaseptin was purified from amphibian skin. It exhibits activity against pathogenic organisms including bacteria; fungi; yeast; and protozoa.
Sequence: ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ
p1025; Acetyl-Adhesin Peptide (1025-1044); amide - Cat# 61891
This p1025 peptide corresponds to the amino acids 1025 to 1044 of the adhesion epitope of Antigen I/II (AgI/II) polypeptide; cell wall anchored adhesion expressed by most oral Streptococci. The p1025 peptide is an adhesion blocking peptide. Application of p1025 to the teeth prevents recolonisation of the cariogenic bacterium Streptococcus mutants in humans.
Sequence: Ac-QLKTADLPAGRDETTSFVLV-NH2
Antimicrobial Anionic Peptide; Surfactant; ovine (DDDDDDD) - Cat# 61881
This is the surfactant-associated ovine antimicrobial anionic peptide (AP) that plays a role in protection of the respiratory tree. This peptide kills several gram-positive and gram-negative bacteria in zinc saline solutions.
Sequence: DDDDDDD
Antimicrobial Anionic Peptide; Surfactant-associated AP (GADDDDD); ovine - Cat# 61880
This anionic peptide (AP); originally isolated from a pulmonary surfactant; is called surfactant-associated AP. In contrast to cationic defensins and beta-defensins; surfactant-associated anionic peptides are smaller in size; opposite in charge; and are bactericidal in zinc saline solution. They are members of another class of peptide antibiotics containing aspartate; which when present in pulmonary secretions may help clear bacteria as a part of the innate pulmonary defense system.
Sequence: GADDDDD
2837b; Hemoglobin Fragment; Plasmepsin II (PM II) substrate; EDANS/ DABCYL - Cat# 62050
The sequence of this synthetic peptide is based on the primary site of cleavage by plasmepsin II (PM II) within hemoglobin (Hb); and numbering of the peptide corresponds to the residue within the ?-chain of Hb. Plasmepsins are involved in the early steps of hemoglobin degradation. They are able to recognize intact hemoglobin and make an initial cleavage in the B helix of the hemoglobin ?-chain between Phe-33 and Leu-34.
Sequence: EDANS-CO-CH2-CH2-CO-ALERMFLSFP-Dap(DABCYL)OH
|