About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Other Genomic Products
Subscribe to AnaSpec Announcements
Email:
Research Topics
AnaSpec News

Sixty-Nine New Peptides - October 26, 2007

This week AnaSpec introduced sixty-nine (69) new catalog peptides to its growing collection.

(pS8; pS13) Eucariotic Translation Initiation Factor 2B (eIF2B); 5-FAM labeled - Cat# 62123
This is eukaryotic protein synthesis initiation factor 2B (elF2B); the double phosphorylated amidated peptide labeled with 5-FAM at the N-terminal. Dephosphorylation of this peptide by insulin signaling; and glycogen synthase kinase 3 (GSK3) inhibition; leads to its activation. The references below correspond to the single phosphorylated peptide.
Sequence: 5-FAM-RRAAEELD-pS-RAG-pS-PQL-NH2

[A90;95] Bid BH3 (77-100); mouse - Cat# 62318
This is amino acids 77 to 100 fragment of Bid BH3 modified murine peptide; with Leu90 and Asp95 replaced by Ala. This peptide may serve as a control for the murine peptide Bid BH3 (77-100). It may be also used in mitochondrial and liposomal release assays.
Sequence: ESQEEIIHNIARHAAQIGAEMDHN

[Ala34]-beta-Amyloid (1-34) - Cat# 62140
This is amino acids 1 to 34 modified fragment of b-Amyloid peptide; with alanine substitution at position 34.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGA

[Arg666; Glu667; Asn670; Leu671;Lys676; Arg677]-beta-Amyloid Precursor Protein. (APP) (666-677); FRET; DABCYL/ EDANS labeled - Cat# 62236
This sequence is developed around the beta-secretase site of Swedish mutation (Asn670; Leu671) of beta-amyloid precursor protein (APP). It is a substrate for the pro-memapsin 2 active site. Beta-secretase; memapsin 2; cleaves APP; which leads ultimately to the onset of Alzheimer's disease. The fluorescence of EDANS is recovered upon cleavage of this FRET peptide substrate by memapsin 2.
Sequence: RE(EDANS)EVNLDAEFK(DABCYL)R

[Asn23]-beta-Amyloid (1-40); (D23N); Iowa Mutation - Cat# 62145
This peptide is naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor (APP). This mutation is associated with severe cerebral amyloid beta-protein angiopathy (CAA) in Iowa kindred. The affected individuals share a missense mutation in APP at position 694. This site corresponds to residue 23 of beta-amyloid peptide resulting in substitution of asparagine for aspartic acid.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV

[C92;96] Bid BH3 (77-100); mouse - Cat# 62319
This is amino acids 77 to 100 fragment of Bid BH3 modified murine peptide with Gln92 and Glu96 replaced by Cys. This peptide may be employed in mitochondrial and liposomal release assays.
Sequence: ESQEEIIHNIARHLACIGDCMDHN

[Lys22]-beta-Amyloid (1-40); Italian Mutation - Cat# 62147
This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22; found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV

[p15]-Gag Region of HIV-1 Subtype C - Cat# 62290
This peptide belongs to the T cell epitope in p15 gag region of HIV-1 subtype C in Balb/c mice.
Sequence: HKGRPGNFLQNRPEPTAP

[pSer884] Thyroid Hormone Binding Protein (TRBP); biotin labeled - Cat# 62286
This peptide is a fragment of the thyroid hormone (TR)-binding protein (TRBP); the LXXLL motif; phosphorylated on Ser884. This peptide interacts with nuclear receptors. Ligand-dependent interaction of nuclear receptors and co-activators is a critical step in nuclear receptor-mediated transcriptional regulation. Serine884 of TRBP LXXLL motif is a key residue for receptor selectivity. The LXXLL-binding affinity correlates with TRBP transcriptional activity.
Sequence: BIOTIN-KDVTLT(pSer)PLLVNLLQSDIS

390 MMP FRET Substrate V - Cat# 62027
This peptide is a substrate for the MMP-12; macrophage elastase. MMPs are considered to be critical mediators of both normal and pathological tissue remodeling processes.
Sequence: Mca-PLGLEEA-Dap(Dnp)-NH2

Adrenal Medulla Chromaffin Vesicles Derived Peptide; ARP - Cat# 62094
This peptide was identified in bovine adrenal medulla chromaffin vesicles. It represents the bovine homolog of similar N-terminal peptides found in mouse brain.
Sequence: ARPVKEP

Aurein 1.1 - Cat# 62043
This peptide belongs to the antibiotic aurein family of peptides. Seventeen aurein peptides are present in the secretion from the granular dorsal glands of the Green and Golden Bell Frog Litoria aurea; and 16 from the corresponding secretion of the related Southern Bell Frog L. raniformis. This aurein 1.1 peptide is one of the most active antibiotics of the aurein family.
Sequence: GLFDIIKKIAESI-NH2

Bacterial Sortase Substrate I; FRET - Cat# 62231
This 5-amino acid peptide is a sortase substrate; C-terminal sorting signal. Sortase cleaves surface proteins at the LPXTG motif and catalyzes the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Sortases are a family of Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer. Cleavage of this FRET substrate by sortase reveals the fluorescent signal; Abs/Em = 340/490 nm.
Sequence: Dabcyl-LPETG-Edans

Bak BH3; Bcl2 (72-87) - Cat# 62235
This 19-amino acid peptide corresponds to the BH3 domain of Bak. Bak is generally recognized as a multidomain; pro-apoptotic member of the Bcl-2 family.
Sequence: KGGGQVGRQLAIIGDDINR

Bak-BH3; TAMRA-labeled - Cat# 62030
This peptide is derived from the BH3 domain of Bak (Flu-BakBH3). It has high-affinity binding to a surface pocket of the Bcl-XL protein that is essential for its death antagonist function. This peptide is labeled with 5-TAMRA on the side chain of lysine at the C-terminus; Abs/Em=544/572 nm..
Sequence: GQVGRQLAIIGDDINR-K(TAMRA)-NH2

Bim-23056 - Cat# 62263
This linear BIM-23056 octapeptide has been reported to behave as a competitive antagonist of the somatostati- SRIFsst5 receptor-mediated activation of phosphoinositide and calcium metabolism. Bim also belongs to a distinct subgroup of pro-apoptotic proteins that resemble other Bcl-2 family members within the short BH3 domain.
Sequence: fFYwKVFnal-NH2

Carnobacteriocin B2 - Cat# 61915-05
This mature 48-amino acid sequence of carnobacteriocin B2 is a well-characterized class II bacteriocin analog of protein produced by a 61-kb plasmid from Carnobacterium piscicola LV17 carnobacteriocin B2. This B2 peptide shows significant amino acid homology to Carnobacteriocin BMI; and with class II bacteriocins which contain the YGNGV amino acid motif near the N terminus.
Sequence: VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP no bond

Caveolin-3 (Cav-3); (55-74) - Cat# 62019
This amino acids 55 to 74 fragment of caveolin-3 is a scaffolding domain peptide (Cav-3); the integral membrane protein. Cav-3; the muscle-specific isoform of caveolins; plays important roles in signal transduction. Together with the caveolin-1; it regulates Ca2+ homeostasis of smooth muscle cells from cerebral resistance arteries. Loss of caveolin-3 resulting from dominant-negative mutations of the caveolin-3 gene causes muscular dystrophy.
Sequence: DGVWRVSYTTFTVSKYWCYR

Claudin-Like Protein 24; CLP24 (212-226); rat - Cat# 62171
This peptide is amino acids 212 to 226 fragment of the membrane and transmembrane claudin-like protein 24; CLP24. This protein is expressed in rat brain tissue.
Sequence: RFRRGLDNDYVESPC

Claudin-Like Protein 24; CLP24; (155-169); rat - Cat# 62173
This is amino acids 155 to 169 fragment of the membrane and transmembrane Claudin-like protein 24 (CLP24). CLP24 contains four predicted transmembrane domains and a C-terminal protein-protein interaction domain. CLP24 is highly expressed in lung; heart; kidney; brain; and placental tissues.
Sequence: TFYRIGPYTNLSWSC

E1; (E257) - Cat# 62194
This peptide is an antagonist variant of OVA (257-264). It induces positive selection on the beta 2M (-/-); and negative selection on beta 2M (+/-) background. This peptide was used to study the ability of the wild-type or mutant TCRs to transduce signals leading to positive or negative selection; and was utilized in several thymocyte development studies. E1 presentation leads to Egr-1 induction and ERK phosphorylation.
Sequence: EIINFEKL

EAK16-II - Cat# 62223
This peptide contains 3 amino acids (Ala; Glu; and Lys) connected into a well-defined 16-amino acid long sequence. EAK16 is a typical member of the self-assembling oligopeptide family. These peptides possess unique charge properties that can sensitively control their aggregation behavior. EAK16-I and -II form fibrillar assemblies. Self-assembling oligopeptides could be considered as a model system for studying insoluble macrostructures found in many neurological disorders such as Alzheimer's disease.
Sequence: AEAEAKAKAEAEAKAK-NH2

e-C2/V1(74-79); e PKC (74-79); C2 Domain - Cat# 62175
This amino acids 74 to 79 fragment of e-C2/VI peptide belongs to the C2 regulatory domain of e-protein kinase C (e-PKC). The C2 domain is also called V1. This peptide increases MARCKS phosphorylation in wild type muscle cells and is found to be cardioprotective.
Sequence: CNGRKI

eNOS (493-512); bovine - Cat# 62234
This is amino acids 493 to 512 fragment of bovine endothelial nitric oxide synthase isoform; termed eNOS. It is bound and activated by the signal-transducing protein calmodulin (CaM) as a result of transient changes in intracellular Ca2+. The eNOS is unique among the NOS isoforms in being targeted to the signal-transducing membrane microdomains termed plasmalemmal caveolae. Coexpression of eNOS and caveolin; the principal structural protein in caveolae; leads to a marked inhibition of eNOS enzyme activity. NOS enzymes are homodimers with each monomer containing a C-terminal reductase domain.
Sequence: TRKKTFKEVANAVKISASLM

FceRI g-Chain - Cat# 61774
This FCeRI g-chain ITAM-derived phosphorylated peptide is a substrate for protein tyrosine phosphatase 1 B (PTP1B). It is responsible for initiating receptor mediated signal transduction through the Syk and Lyn tyrosine kinases.
Sequence: pY-TGLSTRNQET-pY-ETL-NH2

Galanin Like Peptide; GALP; porcine - Cat# 61849-05
This neuropeptide is unique for porcine GALP. It was first isolated from porcine hypothalamus. This peptide shows the GALR2-agonistic activity.
Sequence: APVHRGRGGWTLNSAGYLLGPVLHPPSRAEGGGKGKTALGILDLWKAIDGLPYPQSQLAS

Gamma-TAC4 (32-50) - Cat# 61614
This peptide is amino acids 32 to 50 fragment of gamma-TAC4; N-terminal precursor sequence of endokinin B. Endokinins are the members of the human tachykinin family of neurotransmitters encoded on the human TAC4 gene.
Sequence: AETWEGAGPSIQLQLQEVK

Gastrin-Releasing Peptide (1-17) - Cat# 62096
This peptide is amino acids 1 to 17 fragment of the gastrin-releasing peptide.
Sequence: VPLPAGGGTVLTKMYPR

GLU Construct - Cat# 62108
This peptide construct is derived from the glucan-binding (GLU) region of the mutans streptococcal glucosyltransferase enzymes (GTF). It can provide immunity to dental caries infection. It may have value for inclusion in a synthetic dental caries vaccine.
Sequence: TGAQTIKGQKLYFKANGQQVKG

Glucagon-like Peptide-2; GLP-2 (1-34); rat - Cat# 62069
Glucagon-like peptide-2 (GLP-2) is a peptide located on the C-terminal of the proglucagon precursor. GLP-2 administration to rodents promotes stimulation of crypt cell proliferation and inhibition of enterocyte apoptosis; resulting in hyperplasia of the small bowel villous epithelium. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor.
Sequence: HADGSFSDEMNTILDNLATRDFINWLIQTKITDR

Glucagon-like Peptide-2; GLP-2 (146-178); human - Cat# 62070
This is a fragment of human intestinal growth factor glucagon-like peptide 2; GLP2; containing amino acids 146 to 178. It is an intestinotrophic growth hormone that promotes many aspects of intestinal function; including enhancement of mucosal growth and promotion of nutrient absorption. GLP-2 is a hormone that can rapidly improve intestinal epithelial barrier function.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Glucagon-like Peptide-2; GLP2; (146-178); rat - Cat# 62067
This is amino acids 146 to 178 fragment of rat intestinal growth factor glucagon-like peptide 2; GLP2. Glucagon-like peptides 1 and 2; GLP1 and GLP2; together with glucagon; mini-glucagon; and oxyntomodulin; are derivatives from the 18-kDa mammalian proglucagon protein.
Sequence: HADGSFSDEMNTILDNLATRDFINWLIQTKITD

Homo-Phytochelatin - Cat# 61843
Phytochelatins (PCs) are small enzymatically synthesized peptides having a general structure of [poly-(gamma-Glu-Cys)n-Xaa] polymers where n equals 2 to 11. They are found in all plant species investigated; a few fungal species; and some marine diatoms; where they act as high affinity metal chelators. In iso-phytochelatins; the polymer is capped C-terminally by a serine; glutamine; glutamic acid or in homo-phytochelatin with beta-alanine.
Sequence: gamma-Glu-Cys-gamma-Glu-Cys-beta-Ala

Human Platelet Membrane Glycoprotein Binding Site; GPIb-alpha (580-590) - Cat# 62048
This peptide represents 14-3-3-zeta binding site of human platelet membrane glycoprotein GPIb-alpha. It has a critical role in promoting GPIb-alpha-14-3-3-zeta interaction. The 14-3-3 protein family consists of ubiquitous intracellular adaptor proteins that take part in the signaling pathways of numerous biologic responses. 14-3-3-zeta interacts with the platelet von Willebrand factor (VWF) receptor. Phosphorylation of the Ser587; 590 was demonstrated in resting platelets; dephosphorylation was observed during platelet adhesion and activation on a VWF matrix.
Sequence: LVAGRRPSALS

IL-11R-alpha Binding Peptide II - Cat# 62204
This peptide binds specifically to a corresponding IL-11 receptor (IL-11R-alpha). IL-11R-alpha is a potential target for intervention in human prostate cancer.
Sequence: CGRRAGGSC (S-S bonded)

Influenza Virus Control Peptide Pool - Cat# 62340
These 12 Influenza virus peptides; at 0.25 mg each (total of 3 mg/vial); constitute part of the CEF Control Peptide Pool (cat# 61036-025). Now available separately as Influenza Control Peptide Pool; EBV Control Peptide Pool (cat# 62341) and CMV Control Peptide Pool (cat# 62339); these peptides have been used in the stimulation of IFNg release from CD8+ T cells in individuals with defined HLA types; these epitopes are useful in applications such as ELISPOT; intracellular cytokine and CTL assays. All peptides are provided as net weight based on peptide content. Certificate of Analysis includes data from mass spectrometry; HPLC and amino acid analysis.
Sequence:

Integrin-Binding Site; GRGDNP - Cat# 62049
This RGD-containing sequence is integrin-binding site. RGD peptides are found in both extracellular matrix (ECM) (e.g.; collagen; osteopontin; fibronectin; and vitronectin) and non-ECM proteins (e.g.; disintegrins). RGD-containing peptides are recognized by several integrins. This peptide targets both alphavbeta3 and alpha5beta1 integrins. Interaction of the RGDN sequence with endothelial alpha5beta1 integrin causes endothelin-mediated arteriolar vasoconstriction. This peptide influences the IkappaB kinase (IKK)/nuclear factor-kappaB (NF-kappaB) activation. It also controls the cardiac contractile function.
Sequence: GRGDNP

Interferon Alpha A (101-110); FRET - Cat# 62166
This peptide is amino acids 101 to110 fragment of interferon alpha A fragment. This peptide is labeled with EDANS/ DABCYL FRET pair; Ab/Em= 340/490nm..
Sequence: GVGVTETPLM-(E(EDANS)-GVGVTETPLM-K(DABCYL)-K

LyP-1; Peptide 2 - Cat# 62170
This linear peptide is found in lymphatic tumors; but not in lymphatics in normal tissues.
Sequence: CGNKRTRGC

MAPK-Activated Protein Kinase 5 (MK5) - Cat# 62156
This peptide belongs to the mitogen-activated protein kinases (MAPK)-activated protein kinases (MKs; formerly known as MAPKAP kinases). MK5 is strongly activated in response to cellular stress and proinflammatory cytokines. This enzyme is constitutively nuclear when expressed in resting mammalian cells. Interaction of MK5 with the extracellular-regulated kinase 4(ERK4) leads to translocation of MK5 to the cytoplasm and activation by phosphorylation. This sequence contains the docking motif for p38; though recent data suggest that MK5 is not a physiological substrate for p38 in vivo.
Sequence: IQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSV

MBP (69–88) - Cat# 62085
This is peptide is 69 to 88 amino acids fragment of myelin basic protein. It was used in the experimental autoimmune encephalomyelitis (EAE) studies and tolerance induction research.
Sequence: YGSLPQKSQRSQDENPVVHF

Mitogen- and Stress-Activated Kinase1 (MSK1); D-domain; Fragment 1 - Cat# 62154
This mitogen- and stress-activated kinase (MSK) peptide belongs to the mitogen-activated protein kinases (MAPK)-activated protein kinases (MKs; formerly known as MAPKAP kinases) that mediate cell proliferation; differentiation; motility; and survival. The MK family comprises at least 11 members including this peptide. Almost all MKs possess a docking motif of the D domain class; containing the sequence Leu-Xaa-Xaa-Arg-Arg; followed by one or several basic residues. MSK1 mediates specific interaction with ERK1/2 and p38.
Sequence: FNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTE

Mitogen- and Stress-Activated Kinase2 (MSK2); D-domain; Fragment 2 - Cat# 62155
This peptide belongs to the mitogen-activated protein kinases (MAPK)-activated protein kinases (MKs; formerly known as MAPKAP kinases). It contains the docking domain for the ERK1/2 and p38.
Sequence: FNRGKREGFFLKSVENAPLAKRRKQKLRSATAS

Mundticin - Cat# 61918
Mundticin is a broad-spectrum antimicrobial peptide produced by vegetable-associated Enterococcus mundtii. This antimicrobial peptide belongs to the class IIa bacteriocins of lactic acid bacteria which share a highly conserved N-terminal 'YGNGV' motif. Mundticin was shown to inhibit the growth of Listeria monocytogenes; Clostridium botulinum; and a variety of lactic acid bacteria. Its good solubility in water; stability over a wide pH; and temperature range; indicate the potential of this broad spectrum bacteriocin as a natural preservation agent for foods.
Sequence: KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATGGAAGWSK (Disulfide bridge: 9-14)

Noxa BH3; Peptide 1 - Cat# 62282
This peptide belongs to the Bcl-2 family of proteins. Noxa gene encodes a Bcl-2 homology 3 (BH3)-only member of this family; it contains the BH3 region; not other BH domains. When ectopically expressed; Noxa undergoes BH3 motif-dependent localization to mitochondria; it interacts with anti-apoptotic Bcl-2 family members resulting in the activation of caspase-9.
Sequence: PAELEVECATQLRRFGDKLNFRQKLL

Pancreatic Polypeptide (30-53); human - Cat# 62092
This peptide is amino acids 30 to 53 fragment of the pancreatic polypeptide. It is a member of the pancreatic polypeptide family which consists of at least three naturally occurring peptides: neuropeptide Y (NPY); pancreatic polypeptide (PP); and peptide YY (PYY). This peptide is derived from the N-terminus of the pancreatic polypeptide.
Sequence: APLEPVYPGDNATPEQMAQYAADL

Parathyroid Hormone-Related Protein; PTHrP (107–111) - Cat# 62093
This peptide is a fragment of the parathyroid hormone-related protein; PTHrP; containing amino acids 107 to 111. This region is intensely conserved among species. PTHrP is an ubiquitously expressed protein that regulates cellular and/or organ growth; development; migration; differentiation; survival; calcium ion transport; and other physiological and developmental processes. In addition to a paracrine/autocrine role; PTHrP has
Sequence: TRSAW

Plasmodium yoelii Circumsporozoite Protein; PyCSP (280–288) - Cat# 62087
This peptide is amino acids 280 to 288 fragment of Plasmodium yoelii Circumsporozoite Protein (PyCSP). It was used for cells stimulation in the P. yoelii vaccines studies. PyCSP DNA vaccine induces antibody and CTL response that protects mice from subsequent challenge with live sporozoites; and thus is considered an important model for human anti-malaria vaccine development.
Sequence: SYVPSAEQI

Proapoptotic Chimera Prostate Vasculature Marker - Cat# 62105
This peptide is a proapoptotic chimera that targets vasculature of the normal prostate. The (klaklak)2 is an amphipathic D-amino acid peptide that binds selectively to bacterial; but not eukaryotic cell membranes. If delivered into mammalian cells; the peptide disrupts mitochondria initiating apoptosis. Conjugated through a G-G linker to the peptide that homes to vasculature; this peptide yields a chimeric compound that is selectively cytotoxic to angiogenic endothelial cells.
Sequence: SMSIARL-GG-klaklakklaklak-NH2

Proprotein Convertase Substrate; PC4; Mca-labeled - Cat# 62113
This hexapeptide is most efficiently and selectively cleaved by proprotein convertase 4 (PC4); making it an effective agent for bioassay of PC4 activity. PC4 is a fourth member of Ca2+-dependent mammalian secretory subtilase primarily expressed in testicular germ cell and ovarian macrophage. It plays an important role in sperm fertilization and in early embryonic development. PC4 is a processing enzyme for growth factors IGF-1 and -2; neuropeptide proPACAP and several ADAM proteins such as ADAM-1; -2; -3 and -5.
Sequence: Ac-KTKQLR-MCA

Prostate Vasculature Marker; biotin-labeled - Cat# 62106
The original SMSIARL peptide specifically recognizes vasculature in the prostate. When cloned into T7 phage; it shows a similar homing specificity for the prostate. The accumulation of this peptide in the prostate blood vessels after i.v. injection indicates that this peptide binds selectively to the blood vessels in the prostate. This peptide is biotinylated through 6-aminohexanoate (LC) as a spacer.
Sequence: SMSIARL-K(epsilon-LC-Biotin)

Receptor Interacting Protein 140; RIP 140 - Cat# 62062
This peptide is a fragment of the nuclear factor receptor interacting protein 140; RIP140. RIP140 is a ligand-dependent corepressor for most; if not all; nuclear receptors. It is widely expressed in mammalian cells and may interact with other members of the superfamily of nuclear receptors acting as a potential coactivator of hormone-regulated gene transcription. This nuclear protein modulates transcriptional activation by the estrogen receptor. RIP140 interacts with estrogen receptor in intact cells and modulates its transcriptional activity in the presence of estrogen. RIP140 plays a crucial role in the ovary and in adipose biology.
Sequence: SFSKNGLLSRLLRQNQDSY

Renin 390 FRET Substrate I - Cat# 62022
This peptide is a renin substrate (angiotensinogen) labeled with EDANS/ DABCYL FRET pair for renin activity studies. The renin-angiotensin system (RAS); acting through type 1 angiotensin (AT1) receptors; is a master regulator of fluid homeostasis.
Sequence: R-E(EDANS)-IHPFHLVIHT-K(DABCYL)-R

Rhodopsin Epitope Tag - Cat# 62190
This is a 9-amino acid peptide representing C terminus of bovine rhodopsin widely used as an epitope tag. A number of anti-rhodopsin antibodies recognize this epitope.
Sequence: TETSQVAPA

Ribosomal S6 Kinase 2;bRSK2; (708-740) - Cat# 62158
This is amino acids 708 to 740 fragment of the Ribosomal S6 Kinase 2 (RSK2 ). It is shown to play an important role in cell growth and differentiation; and is linked to a number of human cancers. RSK2 is a mediator of skeletal muscle cell differentiation. N- and C-terminal kinase domains of RSK2 directly interact with nuclear localization signal 1. FGFR3 activates RSK2 to mediate transformation signals by promoting the ERK-RSK2 interaction and subsequent phosphorylation of RSK2 by ERK. This peptide contains the ERK1/2 docking site.
Sequence: SALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL

Scrambled HRP Prorenin Peptide - Cat# 62119

Sequence: RIFLKRMPSI

SNAP-25 (49-58) - Cat# 62314
SNAP-25 is a synaptosomal-associated protein of 25 kDa; a component of the SNARE complex implicated in synaptic vesicle exocytosis. This peptide is a target of clostridial neurotoxins. Botulinum BoNT/A; BoNT/C; and BoNT/E specifically recognize and cut SNAP-25. SNAP-25; vesicle-associated membrane protein (VAMP); and syntaxin are collectively termed SNARE proteins; they act as receptors of soluble N-ethylmaleimide-sensitive factor accessory proteins; involved in vesicle-membrane fusion. Antibody prepared against this peptide shows binding to syntaxin and to VAMP in addition to the expected recognition of SNAP-25.
Sequence: MLDEQGEQLER

Steroid Receptor Coactivator-1 (SRC-1); (676-700); biotin labeled - Cat# 62152

Sequence: Biotin-CPSSHSSLTERHKILHRLLQEGSPS

Steroid Receptor Coactivator-1 (SRC-1); (676-700)-Lys(Biotin); amide - Cat# 62258
This peptide is amino acids 676 to 700 fragment derived from the second LXXLL motif of steroid receptor coactivator (SRC1); modified with Lys(Biotin) coupled to the C-terminus. Coactivator proteins interact with nuclear receptors in a ligand-dependent manner and augment transcription. A short amphipathic alpha-helical domain that includes this LXXLL motif serves as the interaction interface between the coactivator molecules and the ligand-dependent activation function (AF-2) located in the C-terminus of the nuclear receptor ligand-binding domain (LBD). Receptor binding domain of the coactivator SRC-1 is specifically recruited to the farnesoid X receptor (FXR) ligand-binding domain.
Sequence: CPSSHSSLTERHKILHRLLQEGSPS-K(Biotin)-NH2

Tat (48-57) - Cat# 62064
This peptide is amino acid residues 48 to 57 fragment of the basic domain of HIV Tat. It contains the protein transduction domain (PTD) of the HIV Tat protein.
Sequence: GRKKRRQRRR

Tat-C (48-57) - Cat# 62063
This peptide is amino acids 48 to 57 fragment of TAT with an additional cysteine residue at the N-terminus. This peptide contains the protein transduction domain (PTD) of the HIV Tat protein that inhibits HSV-1 entry. The addition of a cysteine residue to the N-terminus of the Tat-PTD (Tat-C peptide) improves the antiviral activity against HSV-1 and HSV-2. Tat-C acts extracellularly; blocking entry of adsorbed virus immediately without eluting virions.
Sequence: CGRKKRRQRRR

TAT-NSF222 Fusion Peptide - Cat# 62240
This sequence is N-ethyl-maleimide-sensitive factor (NSF) peptide connected to 11 amino acid cell permeable human immunodeficiency virus (HIV) transactivating regulatory protein (TAT) domain by Gly-Gly-Gly spacer. This peptide contains NSF domain extending from amino acids 222 to 243; which is directly amino-terminal of the Walker A motif of the D1 domain of NSF. ATPase assay shows that TAT-NSF222 inhibits NSF ATPase activity.
Sequence: YGRKKRRQRRR-GGG-LDKEFNSIFRRAFASRVFPPE

TRAF-binding Motif; acetylated; amide - Cat# 62098
This peptide is a tumor necrosis factor (TNF) receptor-associated factor-(TRAF)-binding motif; with the consensus sequence of PXQXT(S). It has been found in several other TNFR family members and is present in CD40. The TRAF-binding sequence; PVQET; is capable of inducing strong canonical NF-kappaB signaling.
Sequence: Ac-PVQET-NH2

Transcriptional Intermediary Factor 2; Tif-2 (685-697) - Cat# 61994
This 13-amino acid TIF2 peptide with a LxxLL motif is derived from the NR box2 region of TIF2 (SRC2–2). A short consensus motif; so-called nuclear receptor (NR) box; mediates ligand-dependent activation interaction function between nuclear receptors and their coregulators. This TIF2 peptide fragment is sufficient to interact with thyroid hormone ligand binding domain; TR-beta- LBD.
Sequence: EKHKILHRLLQDS

Transdermal Peptide - Cat# 62066
This short synthetic peptide facilitates efficient transdermal protein drug delivery through intact skin. Co-administration of the peptide and insulin to the abdominal skin of diabetic rats results in elevated systemic levels of insulin and suppresses serum glucose levels. This peptide creates a transient opening in the skin barrier to enable macromolecular drugs to reach systemic circulation.
Sequence: ACSSSPSKHCG

Trp Cage - Cat# 62072
This peptide is a C-terminal fragment of exendin-4. This 20-residue construct is over 95% folded in water at physiological pH; and exhibits a tightly folded tertiary structure in solution. Trp Cage is a highly stable mini-protein fold. It consists of a short helix; a 3;10 helix and a C-terminal poly-proline that packs against a Trp in the alpha helix. It is known to fold within 4 nanoseconds. This stable fast-folding Trp Cage sequence displays special stabilizing features specific to this miniprotein.
Sequence: NLYIQWLKDGGPSSGRPPPS

V-ATPase 31; C-terminal - Cat# 62228
This 11-amino acid peptide was derived from the C-terminus of the 31-kD subunit of V-ATPase. This sequence belongs to the cytoplasmic domain of V-ATPase. Kidney V-ATPase is physiologically and structurally identical to vacuolar proton pump. V-ATPase has also been found in osteoclasts; which appears to be responsible for creation of the acidic microenvironment fundamental to bone resorption.
Sequence: CGANANRKFLD

V-ATPase a3 (OC-116); (820-830) - Cat# 62227
This is C-terminal fragment of the vacuolar proton translocating ATPase polypeptide subunit a-isoform 3; known also as the osteoclastic proton pump 116 kDa subunit (OC-116). This a3 subunit of the vacuolar proton pump mediates the acidification of the bone/osteoclast interface. Mutations of this protein are responsible for a subset of malignant infantile osteopetrosis.
Sequence: LSPFTFAATDD

Vesicle-Associated Membrane Protein; VAMP; (62-71) - Cat# 62316
This is amino acids 62 to 71 fragment of the vesicle-associated membrane protein (VAMP) or synaptobrevin. VAMP is a constituent of the synaptic vesicles that participate in neuromediator release. Antibody prepared against this peptide has an inhibitory effect on proteolysis of VAMP by botulinum and tetanus neurotoxins.
Sequence: ELDDRADALQ

  < Back