|
60 New Peptides & 3 New Assay Kits - May 21, 2008
This week AnaSpec introduced sixty (60) new catalog peptides and three (3) new assay kits.
[Phe668]-Amyloid Precursor Protein (APP) (659-676) - Cat# 62289
This is amino acids 659 to 676 fragment of the amyloid precursor protein with Thr668 substituted by Phe668.
Sequence: GVVEVDAAVFPEERHLSK
Beta-Amyloid (17-21)-Lys(Biotin) - Cat# 62467
This is amino acids 17 to 21 fragment of beta-amyloid labeled; with biotin on the side chain of lysine.
Sequence: LVFFA-K(Biotin)
Protein G B1 Domain (41-56), beta-hairpin (BHA) - Cat# 62532
This beta-hairpin (BHA) peptide is amino acid residues 41 to 56 fragment from the B1 domain of protein G. BHA is a 16-residue peptide that adopts a stable beta-hairpin structure in aqueous solution with a population of ~40%. In water; BHA adopts a twisted conformation around the peptide axis. In 30% (vol/vol) TFE/water solution; the beta-hairpin population further increases up to ~60%.
Sequence: GEWTYDDATKTFTVTE
[Glu3]-RGES, Control for RGD Peptides - Cat# 62527
This peptide is a control for the RGDS Fibronectin Active Fragment and other RGD-related peptides. Asp3 is replaced by Glu3 in RGDS peptide changing its properties to inhibit integrins and proteins of extracellular matrix binding.
Sequence: RGES
Coagulation factor IX Fragment A - Cat# 62374
This peptide is fragment A of the coagulation factor IX; a part of the plasma thromboplastic component. The peptide is related to hemophilia.
Sequence: TEAETILDNI
Cytomegalovirus Proteinase Substrate - Cat# 62786
This peptide is a substrate for the human cytomegalovirus (hCMV) protease. Viruses of the herpes family; including the hCMV and herpes simplex virus; encode a protease essential for viral capsid formation and viral replication. hCMV protease cleaves this substrate at Ala6.
Sequence: RGVVNASSRLA
SMR1-Related Undecapeptide - Cat# 62674
This peptide is a synthetic analog of the undecapeptide generated in-vivo from submandibular rat 1 protein (SMR1) by cleavage at pairs of arginine residues. The mature peptide; which accumulates in the male submandibular gland; is exported into the extracellular space in response to a specific external stimulus and in this way is transported within the salivary and blood fluids. This peptide has a local and systemic physiological role in mediating some male-specific behavioral characteristics.
Sequence: VRGPRRQHNPR
P. falciparum Liver-Stage Antigen 3-NRI (LSA3-NRI) - Cat# 62550
This peptide is a fragment of the Plasmodium falciparum liver-stage antigen 3 (LSA3); T9-96 clone; a preerythrocytic antigen that induces protection against malaria in chimpanzees. The development of a malaria preerythrocytic vaccine has been greatly influenced by the observation that sterile immunity could be experimentally induced in humans by immunization with Plasmodium falciparum radiation-attenuated sporozoites.
Sequence: DELFNELLNSVDVNGENILEESQ
Survivin (85–93) - Cat# 62691
This is amino acids 85 to 93 fragment of survivin derived from the exon 3-encoded region. Survivin has a capability to inhibit caspase-3; -7; and -9 in the cells receiving apoptotic stimulus.
Sequence: AFLSVKKQF
[pSer155]-BAD BH3 (146-159) - Cat# 62482
This is amino acids 146 to 159 fragment of BAD BH3 protein; phosphorylated at Ser155. Phosphorylation of BAD at Ser155 within the BH3 domain is a mechanism that inhibits the death-promoting activity of BAD. Protein kinase A; RSK1; and survival factor signaling stimulate phosphorylation of BAD at Ser155; blocking the binding of BAD to Bcl-XL. RSK1 may also phosphorylate BAD at Ser112 and Ser155 and rescue BAD-mediated cell death in a manner dependent upon phosphorylation at both sites.
Sequence: RYGRELRRM-pS-DEFE
Bak BH3 (73-87) - Cat# 62480
This is amino acids 73 to 87 fragment of Bak BH3 protein. Synthetic BH3 peptides can bind to Bcl-2-like death suppressors and block heterodimerization with pro-apoptotic Bcl-2 homologs in vitro. Bak BH3 peptides bind to Bcl-XL and interfere with its anti-apoptotic function. This 15-amino acid Bak BH3 peptide greatly attenuates the protective effect of Bcl-XL.
Sequence: QVGRQLAIIGDDINR
2Wp, Class II MHC Molecule - Cat# 62552
This 12 amino acids peptide is presented by the mouse class II MHC molecule; IAb. It was shown to bind with high specificity to T cell hybridomas.
Sequence: AWGALANWAVDS
LCMV (2062-2069), L2062 - Cat# 62543
This peptide is amino acids 2062 to 2069 fragment of the lymphocytic choriomeningitis virus (LCMV); product of the L-RNA segment; also known as L2062. It is the H-2Db restricted epitope with relatively high CD8+ T-cell response. CD8+ T-cell responses control lymphocytic choriomeningitis virus infection in H-2b mice.
Sequence: RSIDFERV
EBV 2A.32 - Cat# 62690
This peptide is derived from the EBV latent membrane protein 2A.32; a HLA-A*2402-restricted epitope.
Sequence: TYGPVFMSL
PLL (889–900), H/K-ATPase alpha-Chain Peptide (889–900) - Cat# 62089
This PLL peptide is a fragment of the gastric hydrogen potassium ATPase or H+/K+ ATPase which is the proton pump of the stomach. It was employed in several autoimmune gastritis studies.
Sequence: PLLCVGLRPQWE
[Asn670, Leu671]-Amyloid Precursor Protein (APP) (668-676), Swedish Mutation - Cat# 62515
This amino acids 668 to 675 fragment of amyloid precursor protein is a substrate for memapsin 2 (BACE1). Memapsin 2 is a membrane-anchored aspartic protease that is involved in the cleavage of beta-amyloid precursor protein to form beta-amyloid peptide. This beta-amyloid peptide sequence contains two amino acids replaced with N670 and L671 corresponding to the Swedish mutation of APP.
Sequence: EVNLDAEF
Biotin-beta-Amyloid (18-28) - Cat# 62448
This is amino acids 18 to 28 fragment of the beta-amyloid peptide biotinylated at the N-terminus. Intracerebroventricular administration of synthetic peptides A beta (12-20 ); (12-28) and (18-28) causes amnesia in mice. These peptides have only amino acid residues VFF at position 18 to 20 in common; suggesting the amnestic effect of the triad.
Sequence: Biotin-VFFAEDVGSNK
Biotin-LC-beta-Amyloid (22-41) - Cat# 62455
This is amino acids 22 to 41 fragment of beta-amyloid peptide; biotinylated through an LC spacer at the N-terminus.
Sequence: Biotin-LC-EDVGSNKGAIIGLMVGGVVI
HspB8 (181-194) - Cat# 62593
This is a C-terminal sequence of the small heat shock protein HspB8; amino acids 181 to 194 fragment. HspB8 functions as a molecular chaperone. HspB8 (also known as H11); the eukaryotic homolog of a herpes simplex virus protein; has the crystallin motif of heat shock proteins (HSP). This peptide was used as an antigen for the H11-181 antibody.
Sequence: SFNNELPQDSQEVT
Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) - Cat# 62565
This chimeric peptide is a fragment derived from rabies virus glycoprotein (RVG). Because neurotropic viruses cross the blood-brain barrier to infect brain cells; the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. To enable siRNA binding; this chimeric peptide was synthesized by adding nonamer arginine residues at the carboxy terminus of RVG. This RVG-9R peptide was able to bind and transduce siRNA to neuronal cells in vitro; resulting in efficient gene silencing. After intravenous injection into mice; RVG-9R delivered siRNA to the neuronal cells; resulting in specific gene silencing within the brain. RVG-9R provides a safe and noninvasive approach for the delivery of siRNA and potentially other therapeutic molecules across the blood–brain barrier.
Sequence: YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Mastoparan X - Cat# 62647
This peptide is the mastoparan modification with Leu3 to Trp3; Ala5 to Gly5; Leu6 to Ile6; Leu9 to Met9; Ile13 to Leu13; referred as mastoparan X (MPX). Mastoparan is an amphiphilic tetradecapeptide isolated from wasp venom. It is known to possess a variety of biological activities including mast cell degranulation; mobilization of Ca2+ from cerebellar microsomes and sarcoplasmic reticulum; and modulation of various enzymes. This mastoparan analog; MPX; as well as mastoparan 7 (MP7); has similar effects on ATPase activity as mastoparan itself. The ability of mastoparan analogs to interact with the Ca2+-ATPase and inhibit it; correlates with their ability to adopt ordered conformations in membranes as well as their amphiphilicity.
Sequence: INWKGIAAMAKKLL-NH2
Nociceptin (1-11), (Orphanin FQ, or OFQ/N) (1-11) - Cat# 62610
This peptide is amino acids 1 to 11 fragment of nociceptin (orphanin FQ; OFQ/N). The complete OFQ/N sequence contains pairs of basic amino acids that might imply additional processing of the peptide to this OFQ/N 1 to 11 fragment. This truncated peptide is functionally active when administered in vivo producing analgesia that is reversed by opioid antagonists. The peptide shows no appreciable affinity for any of the traditional opioid receptors.
Sequence: FGGFTGARKSA
Nociceptin (1-7), (Orphanin FQ, or OFQ/N) (1-7) - Cat# 62611
This peptide is amino acids 1 to 7 fragment of nociceptin (orphanin FQ; OFQ/N). The complete OFQ/N sequence contains pairs of basic amino acids that might imply additional processing of the peptide to this OFQ/N 1 to 7 fragment. This truncated peptide is functionally active when administered in vivo producing analgesia that is reversed by opioid antagonists. The peptide shows no appreciable affinity for any of the traditional opioid receptors.
Sequence: FGGFTGA
Prepronociceptin (169-176), human - Cat# 62612
This octapeptide is amino acids 169 to 176 fragment processed from the precursor prepronociceptin (PPNOC); the common precursor to the neuropeptide nociceptin (orphanin FQ; OFQ/N). Mouse and rat octapeptides display the same sequence; but are located at amino acids 180 to 187 (mouse); and 174 to 181 (rat) of prepronociceptin sequences.
Sequence: TLHQNGNV
Fibronectin (1906-1924) - Cat# 62581
This amino acids 1906 to 1924 fragment of the fibronectin (FN) is known to promote heparin binding. This peptide also binds CD44 lymphocyte antigen. CD44 shows weak; but clearly over background binding to this sequence.
Sequence: YEKPGSPPREVVPRPRPGV
Fibronectin (1946-1960), FN-C/H2 - Cat# 62578
This amino acids 1946 to 1960 peptide fragment; derived from the C-terminal heparin-binding domain of fibronectin (FN); mediates cell adhesion for variety of cell types and promotes cell outgrowth. Mouse melanoma cell adhesion to this FN fragment is mediated by phosphatidylinositol-anchored heparin sulfate proteoglycan (HSPG). This peptide also binds CD44 lymphocyte antigen.
Sequence: KNNQKSEPLIGRKKT
Fibronectin (1951-1960), FN-C/H2-COOH - Cat# 62580
This is amino acids 1954 to 1960 fragment of the C-terminal heparin-binding domain of fibronectin (FN). It displays cell adhesion and phosphatidylinositol-anchored heparin sulfate proteoglycan (HSPG) binding activities; which are attributed in part to the cluster of basic residues (RKK) present on this peptide.
Sequence: SEPLIGRKKT
Fibronectin (1954-1960) - Cat# 62579
This amino acids 1954 to 1960 peptide fragment derived from the C-terminal heparin-binding domain of fibronectin (FN) is biologically active with the most basic structural features necessary for cell adhesion activity. It can form a helix-like conformation in solution. The tripeptide (RKK) sequence is of a paramount importance to heparin sulfate binding.
Sequence: LIGRKKT
YRGDS Fibronectin Fragment - Cat# 62654
This is a fibronectin fragment; an adhesion peptide that shows strong binding affinity to thrombin-stimulated platelets. It is RGD containing sequence.
Sequence: YRGDS
Cyclo (-RADfK-), RGD negative control - Cat# 62351
This peptide is a negative control for the cyclo (-RGDfK-); the RGD peptide. RGD peptides are modulators of cell adhesion and are recognized by several members of the integrin family. This peptide has low affinity binding to integrin peptides.
Sequence: Cyclo(-RADfK-)
Leptin (22-56), human - Cat# 62558
This is amino acids 22 to 56 fragment of leptin. Leptin is an adipocyte hormone important in appetite; energy homeostasis; neuroendocrine and hematopoietic function. Leptin correlates weakly with the erythropoietin to hematocrit ratio (T = -0.20; P=0.14); while this leptin fragment (22-56) has a significant negative correlation with this index (T=-0.42; P<0.01); suggesting that this fragment may favour hematopoiesis.
Sequence: VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQK
V3 gp120 HIV (AD-11) - Cat# 62583
This peptide is derived from the V3 region of the gp120 surface glycoprotein of HIV type 1. It contains the canonical 19b epitope –I----G—FY-T that is recognized by the human Mab19b antibody. In this epitope; residues indicated at the positions by the gaps do not contribute directly to the 19B antibody binding site. The canonical 19b epitope is well conserved among isolates of North American-European clade B; clade E of Thailand isolates and clade E from Brazil. This peptide displays strong binding with Mab19b.
Sequence: SIPIGPGRAFYTT
V3 gp120 HIV (WM) - Cat# 62584
This peptide is derived from the V3 region of the gp120 surface glycoprotein of HIV type 1. It contains the canonical 19B epitope –I----G—FY-T that is recognized by the human Mab19B antibody. In this epitope; residues indicated at the positions by the gaps do not contribute directly to the 19B antibody binding site. The canonical 19B epitope is well conserved among isolates of North American-European clade B; clade E of Thailand isolates and clade E from Brazil. This peptide displays exceptional binding with Mab19B.
Sequence: GIHIGPGKAFYTT
PAR-3 (1-6), human - Cat# 62657
This is amino acids 1 to 6 fragment of the protease-activated receptor 3 (PAR-3). This synthetic peptide induces ERK activation in human carcinoma cells endogeneously expressing PAR1 and PAR3. This effect is completely abolished by single alanine substitution at positions 3; 4 and 6 in the peptide. PAR-3 allosterically regulates PAR1 signaling by receptor dimerization governing increased endothelial permeability. Targeting of PAR3 may mitigate the effects of PAR1 in activating endothelial responses such as vascular inflammation. However this peptide does not affect VEGF release or expression.
Sequence: TFRGAP-NH2
Caloxin 2A1 - Cat# 62604
Caloxins are extracellular plasma membrane (PM) Ca2+ pump inhibitors. Caloxin 2A1 is a PM Ca2+ pump inhibitor selectively binding to an extracellular domain. It inhibits Ca2+-Mg2+-ATPase in human erythrocyte leaky ghosts. Caloxin 2A1 is active at an extracellular site; the peptide can simply be added exogenously to inhibit the plasma membrane calcium ATPase (PMCA).
Sequence: VSNSNWPSFPSSGGG
Caloxin 3A1 - Cat# 62606
This peptide belongs to caloxins; the extracellular plasma membrane (PM) Ca2+ pump inhibitors. Caloxin 3A1 inhibits plasma membrane calcium pumps (PMCAs) but not the sarcoplasmic reticulum Ca2+-pump. This peptide does not inhibit formation of the acylphosphate intermediate from ATP.
Sequence: WSSTSSVSAPLEFGGGGSAK
HBVpol575HBV polymerase (575-583) - Cat# 61597
This is the hepatitis B virus (HBV) HLA-A2-restricted HBV CTL epitope. HBV is a noncytopathic DNA virus that causes acute and chronic hepatitis and hepatocellular carcinoma.
Sequence: FLLSLGIHL
Hexon Protein Fragment - Cat# 62632
This peptide is a fragment of the adenoviral hexon. Hexon is the major capsid protein of adenovirion and is comprised of three identical polypeptide chains.
Sequence: KYSPSNVKI
MBP (131–155) - Cat# 62598
This amino acids 131 to 155 fragment of the myelin basic protein (MBP) is the dominant encephalitogenic peptide. This peptide was used to study T cell reactivity in multiple sclerosis (MS) patients.
Sequence: ASDYKSAHKGLKGVDAQGTLSKIFK
MBP (146–170), Myelin Basic Protein (146–170) - Cat# 62591
This amino acids 146 to 170 fragment of the myelin basic protein (MBP) is the dominant encephalitogenic peptide. This myelin epitope contributes to the increased T cell reactivity observed in a cohort of untreated multiple sclerosis (MS) patients.
Sequence: AQGTLSKIFKLGGRDSRSGSPMARR
GSM Peptide - Cat# 62384
This 22 amino acid peptide is specifically phosphorylated by protein kinase glycogen synthase kinase-3 beta (GSK-3 beta); and can be used to detect its activity. GSK-3ß has been shown to regulate cytoplasmic beta-catenin levels.
Sequence: RRRPASVPPSPSLSRHSSHQRR
Neuropeptide S, NPS, chicken - Cat# 62618
This is a chicken neuropeptide S (NPS); the endogenous ligand of an orphan G protein-coupled receptor (GPCR). NPS potently modulates wakefulness and regulates anxiety.
Sequence: SFRNGVGSGIKKTSFRRAKS
Neuropeptide S, NPS, chimpanzee, dog - Cat# 62617
This is the neuropeptide S (NPS) from chimpanzee and dog; the endogenous ligand of an orphan G protein-coupled receptor (GPCR). NPS potently modulates wakefulness and regulates anxiety.
Sequence: SFRNGVGTGMKKTSFRRAKS
TRPA1, C-terminal fragment - Cat# 62061
TRPA1 is an excitatory ion channel on primary sensory neurons of the pain pathway. It is a member of the TRP channel family. These nonselective cation channels are expressed by a subset of unmyelinated C-fiber nociceptors; whose activation elicits acute pain accompanied by vasodilation; vascular leakage; and inflammation.
Sequence: CVLNAVKTKTHCSISHPDI
Histone 4 (1-21)-Lys(Biotin) - Cat# 62555
This sequence is amino acids 1 to 21 fragment of the histone 4; acetylated at the N-terminus and biotinylated on the side chain of Lys. A GG spacer has been added on the C-terminus of Lys.
Sequence: Ac-SGRGKGGKGLGKGGAKRHRKVGG-K(Biotin)
BAD (NT-1) - Cat# 62270
This peptide is N-terminal sequence of BAD that belongs to the Bcl-2 family of proteins; the key regulators of apoptosis. The members of the Bcl-2 family include both death antagonists such as Bcl-2 and Bcl-XL and death agonists such as Bad; Bak; Bid; and Bax.
Sequence: PEFEPSEQEDSSSAERC-NH2
Metalnikowin I - Cat# 62603
This is the antibacterial peptide active against Gram-negative bacteria.
Sequence: VDKPDYRPRPRPPNM
flg15, Flagellin Fragment - Cat# 62634
This is 15 amino acids flagellin peptide known as flg15. It spans the core domain necessary for binding and biological activity in plant cells. This peptide spanning the 15 amino acids in the core of the conserved domain induces responses after treatment with fungal elicitors such as chitin fragments; xylanase; ergosterol; and high-mannose–type glycopeptides when applied in subnanomolar concentrations. Flagellin is the structural protein that forms the major portion of flagellar filaments. It is an elicitor of defense-related responses in cells from various plant species. Flagellins from different bacterial species vary in their central part but show conservation of their N-terminal and C-terminal regions
Sequence: RINSAKDDAAGLQIA
flg15-delta-4, Flagellin Fragment - Cat# 62635
This is 11 amino acids flagellin peptide is known as flg15-delta-4. It is a protein subunit building up the filament of the bacterial flagellum; an elicitor of defense-related responses in cells from various plant species. flg15-delta-4 acts as a potent antagonist for flagellin elicitors.
Sequence: RINSAKDDAAG
[pThr145]-p21 (140-147) - Cat# 62613
This peptide; amino acids 140 to 147 fragment of p21; is phosphorylated on Thr145. Pim-1 can efficiently phosphorylate p21 on Thr145 in vitro. Pim-1 is a serine/threonine kinase involved in the transduction of cytokine-triggered mitogenic signals. When p21 is phosphorylated on Thr145; it localizes to the nucleus and causes the disruption of the association between proliferating cell nuclear antigen and p21. Phosphorylation of Thr145 promotes stabilization of p21.
Sequence: RKRRQ-pT-SM
Cys-p21 (139–154) - Cat# 62616
This peptide is amino acids 139 to 154 fragment of p21; a key regulator of cell growth and differentiation. Cys is added to the N-terminal of the peptide for the use in immunological assays.
Sequence: CGRKRRQTSMTDFYHSK
Maspin Reactive Site Loop (RSL), (330-345 ) - Cat# 62576
This is amino acids 330 to 345 fragment of maspin; which is the maspin reactive site loop (RSL) of this protein. Maspin inhibits tumor invasion and induces cell adhesion to extracellular matrix molecules. RSL alone induces cell-matrix adhesion of mammary carcinoma cells and corneal stromal cells and inhibits invasion of the carcinoma cells. Maspin is a 42-kDa protein synthesized by normal epithelial cells of a variety of mammalian organs such as mammary gland; prostate; skin; and cornea.
Sequence: GGDSIEVPGARILQHK
HB-1 (18-41) - Cat# 62512
This is amino acids 18 to 41 fragment of HB-1; a polymorphic tumor-associated antigen (TAA). B-cell leukemia-associated antigen HB-1 is able to induce both CD4+ Th and CD8+ CTL responses; thus HB-1 might be a suitable target for B-ALL–specific immunotherapy.
Sequence: WKSELVEVDDVYLRHSSSLTYRL
p21 (140-147) - Cat# 62614
This peptide is amino acids 140 to 147 fragment of p21. It contains two phosphorylation sites at Thr145 and Ser 146 that are important in signal transduction and stabilization of p21.
Sequence: RKRRQTSM
MMK-1 - Cat# 62519
This is a formyl peptide receptor like 1 (FPRL1 ) antagonist. It was recently reported to mobilize Ca2+ via lipoxin A4 receptors (ALXRs); and to stimulate human polymorphonuclear leukocyte chemotaxis.
Sequence: LESIFRSLLFRVM
NY-ESO-1 (158–180) - Cat# 62656
This peptide is amino acids 158 to 181 fragment of the NY-ESO-1. It is a HLA-DPB1*0401-restricted sequence. It has less binding affinity to other HLA-DR molecules. The NY-ESO-1 antigen is expressed by many tumors of different histological types (including breast; prostate; lung; and melanoma) and by male germline cells; but not by normal tissues.
Sequence: LLMWITQCFLPVFLAQPPSGQRR
Hyaluronan Inhibitor - Cat# 62622
This 12 amino acids peptide is a hyaluronan inhibitor (HA); a high molecular weight glycosaminoglycan expressed abundantly in the extracellular matrix and on cell surfaces. This peptide shows specific binding to soluble; immobilized; and cell-associated forms of HA; and it inhibits leukocyte adhesion to HA substrates almost completely.
Sequence: GAHWQFNALTVR
37, 40 GAP26, Connexin Mimetic - Cat# 62639
This peptide corresponds to the GAP26 domain of the extracellular loop of the major vascular connexins (Cx37; Cx40); designated as 37;40Gap 26 according to Cx homology. It was used to investigate the role of gap junctions in the spread of endothelial hyperpolarizations evoked by cyclopiazonic acid (CPA) through the wall of the rodent iliac artery. The gap junction plaques constructed from Cx37 and Cx40 were abundant in the endothelium. This peptide provides inhibitory effects against subintimal hyperpolarization.
Sequence: VCYDQAFPISHIR
40Gap 27, Connexin Mimetic - Cat# 62641
This peptide corresponds to the GAP27 domain of the second extracellular loop of dominant vascular connexin (Cx40); designated as 40Gap 27. It was used to investigate mechanisms through which oxidant stress impairs communication via gap junctions. When administered; 40Gap27attenuates endothelium-dependent subintimal smooth muscle hyperpolarization.
Sequence: SRPTEKNVFIV
43Gap 36, Connexin Mimetic - Cat# 62643
This peptide corresponds to the GAP36 domain of connexin; highly conserved extracellular loop fragment that is shown to be effective in restricting the propagation of mechanically induced Ca2+ waves. Connexin mimetic peptides are effective and reversible inhibitors of gap junctional communication of physiologically significant molecules that underlie Ca2+ wave propagation in epithelial cells. The amino acid region SRPTEK of this sequence is a crucial contributor to the docking of connexons for generating gap junctions.
Sequence: KRDPCHQVDCFLSRPTEK
SensoLyte™ 440 Cathepsin S Assay Kit *Fluorimetric* - Cat# 72100
Cathepsins are a class of globular lysosomal proteases playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases; atherosclerosis; cancer; obesity and related diseases.The SensoLyte™ 440 Cathepsin S Assay Kit uses a fluorogenic peptide for measurement of enzyme activity. This peptide releases the AMC (7-amino-4-methylcoumarin) fluorophore upon cathepsin S cleavage; and which can be detected with excitation at 354 nm and emission at 442 nm. The kit contains: • AMC based fluorogenic substrate (Ex/Em=354 nm/442 nm upon cleavage) • Assay buffer • Human spleen Cathepsin S • Inhibitor • Fluorescence reference standard for calibration • A detailed protocol
Sequence:
SensoLyte™ 520 Cathepsin S Assay Kit *Fluorimetric* - Cat# 72099
Cathepsins are a class of globular lysosomal proteases playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases; atherosclerosis; cancer; obesity and related diseases.The SensoLyte™ 520 Cathepsin S Activity Assay Kit uses a 5-FAM/QXL™520 labeled FRET peptide substrate for measurement of enzyme activity. In the intact FRET peptide; the fluorescence of 5-FAM is quenched by QXL™ 520. Upon cleavage of the FRET peptide by the active enzyme; the increase of fluorescence can be continuously monitored at excitation/emission = 490 nm/520 nm. With superior fluorescence quantum yield and longer emission wavelength; the 5-FAM/QXL™ 520 based FRET peptide shows less interference from the autofluorescence of test compounds and cellular components and provides better assay sensitivity. The kit can be used to detect the activity of Cathepsin S enzyme in biological samples and purified enzyme preparations. The kit contains: • 5-FAM/QXL™520-based FRET peptide substrate (Ex/Em=490/520 nm upon cleavage) • Assay buffer • Human spleen Cathepsin S • Inhibitor • Fluorescence reference standard for calibration • A detailed protocol
Sequence:
SensoLyte™ 570 Generic MMP Assay Kit *Fluorimetric* - Cat# 72101
345
Sequence: Kit size: 100 assays
|