Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Hepatitis C Virus (HCV) Related Peptides  >>  PEP1

Product Name PEP1
SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD - NH2
Size 1 mg
Catalog # AS-60430-1
US$ $291
Purity % Peak Area By HPLC ≥ 95%
Description

This synthetic peptide mimics wild-type AH (amphipathic helix) and inhibits membrane association of NS5A, hence impairing HCV replication.

Detailed Information Datasheet
Storage -20C
References Ref: Glenn, JS. et al. J. Virol. 77, 6055 (2003).
Molecular Weight 3805.3
Sequence
(One-Letter Code)
SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
Sequence
(Three-Letter Code)
Ser - Gly - Ser - Trp - Leu - Arg - Asp - Val - Trp - Asp - Trp - Ile - Cys - Thr - Val - Leu - Thr - Asp - Phe - Lys - Thr - Trp - Leu - Gln - Ser - Lys - Leu - Asp - Tyr - Lys - Asp - NH2
     
  < Back