Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

PEP1

Product Name	PEP1
Size	1 mg
Catalog #	60430-1
US$	$291
Purity	% Peak Area By HPLC ≥ 95%
Description	This synthetic peptide mimics wild-type AH (amphipathic helix) and inhibits membrane association of NS5A, hence impairing HCV replication.
Detailed Information	Datasheet
Storage	-20°C
References	Ref: Glenn, JS. et al. J. Virol. 77, 6055 (2003).
Molecular Weight	3805.3
Sequence (One-Letter Code)	SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
Sequence (Three-Letter Code)	Ser - Gly - Ser - Trp - Leu - Arg - Asp - Val - Trp - Asp - Trp - Ile - Cys - Thr - Val - Leu - Thr - Asp - Phe - Lys - Thr - Trp - Leu - Gln - Ser - Lys - Leu - Asp - Tyr - Lys - Asp - NH2