Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Gastric Inhibitory Peptides (GIPs)  >>  GIP (1-42), human

Product Name GIP (1 - 42), human
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Size 0.5 mg
Catalog # AS-61226-05
US$ $198
Purity % Peak Area By HPLC ≥ 95%
Description

GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.

Detailed Information Datasheet
Storage -20C
References Brown, JC & JR Dryburgh Can J Biochem 49, 867 (1971), doi: 10.1139/o71-122
Buchan, MT. et al. Histochem 56, 37
Dupre, J. et al. J Clin Endocrinol Metab 37, 826 (1973), doi: http://dx.doi.org/10.1210/jcem-37-5-826
Getty-Kaushik, L. et al. Obesity 14, 1124, doi: 10.1038/oby.2006.129
Molecular Weight 4983.6
Sequence
(One-Letter Code)
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Sequence
(Three-Letter Code)
H - Tyr - Ala - Glu - Gly - Thr - Phe - Ile - Ser - Asp - Tyr - Ser - Ile - Ala - Met - Asp - Lys - Ile - His - Gln - Gln - Asp - Phe - Val - Asn - Trp - Leu - Leu - Ala - Gln - Lys - Gly - Lys - Lys - Asn - Asp - Trp - Lys - His - Asn - Ile - Thr - Gln - OH
     
  < Back