Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Gastrins  >>  Big Gastrin-1, human

Product Name Big Gastrin - 1, human
Pyr - LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF - NH2
Size 0.5 mg
Catalog # AS-20747
US$ $259
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Ref: Choudhury, A. et al. Hoppe-Seyler?s Z. Physiol. Chem. 361, 1719 (1980).
Molecular Weight 3849.3
Sequence
(One-Letter Code)
Pyr-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2
Sequence
(Three-Letter Code)
pGlu - Leu - Gly - Pro - Gln - Gly - Pro - Pro - His - Leu - Val - Ala - Asp - Pro - Ser - Lys - Lys - Gln - Gly - Pro - Trp - Leu - Glu - Glu - Glu - Glu - Glu - Ala - Tyr - Gly - Trp - Met - Asp - Phe - NH2
     
  < Back