Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid Peptide Fragments  >>  Beta-Amyloid (1-33), Human

Product Name Beta - Amyloid (1 - 33), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
Size 1 mg
Catalog # 60250-1
US$ $413
Purity % Peak Area By HPLC ≥ 95%
Description

Purified metalloendopeptidase cleaves the Gly33-Leu34 bond of Alzheimer A (1-40) peptide producing soluble 1-33 and 34-40 fragments of A (1-40) without any neurotoxic effects.

Storage -20C
References Ref: Carvalho, K. et al. Braz. J. Med. Biol. Res. 30, 1153 (1997); Maddalena, A. et al. Neurodegenerative Dis. 1, 231 (2004).
Molecular Weight 3674
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - OH
     
  < Back