Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid Peptide Fragments  >>  Beta-Amyloid (1-37), Human

Product Name Beta - Amyloid (1 - 37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Size 0.5 mg
Catalog # 60251-05
US$ $264
Purity % Peak Area By HPLC ≥ 95%
Storage -20°C
Molecular Weight 4074.6
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - OH
Product Citations Reza, M. et al. (2010). Microchip electrophoresis profiling of Aβ peptides in the cerebrospinal fluid of patients with Alzheimer’s disease. Anal Chem 82, 7611.
     
  < Back