Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid Peptide Fragments  >>  Beta-Amyloid (1-38), Human

Product Name Beta - Amyloid (1 - 38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Size 1 mg
Catalog # AS-24234
US$ $275
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
Molecular Weight 4131.6
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - OH
Product Citations Dillen, L. et al. (2011). A screening UHPLC–MS/MS method for the analysis of amyloid peptides in cerebrospinal fluid of preclinical species. Bioanalysis 3, 45.
Reza, M. et al. (2010). Microchip electrophoresis profiling of Aβ peptides in the cerebrospinal fluid of patients with Alzheimer’s disease. Anal Chem 82, 7611.
     
  < Back