Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid Peptide Fragments  >>  Beta-Amyloid (1-39), Human

Product Name Beta - Amyloid (1 - 39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Size 0.5 mg
Catalog # AS-24295
US$ $181
Purity % Peak Area By HPLC ≥ 95%
Description

A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease. The length of the C-terminus is a critical determinant of the rate of amyloid formation (“kinetic solubility”), with only a minor effect on the thermodynamic solubility. Amyloid formation by the kinetically soluble peptides (e.g. 1-39) can be nucleated, or “seeded” by peptides which include the critical C-terminal residues (1-42, 26-42, 26-43, 34-42).

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref; Jarrett, JT. et al. Biochem. 32, 4693 (1993); Giacomelli, CE. and W. Norde, Macromol. Biosci. 5, 401 (2005).
Molecular Weight 4230.7
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - OH
Product Citations Reza, M. et al. (2010). Microchip electrophoresis profiling of Aβ peptides in the cerebrospinal fluid of patients with Alzheimer’s disease. Anal Chem 82, 7611.
Good, TA. et al. (1999). Beta-amyloid peptide blocks the fast-inactivating K+ current in rat hippocampal neurons. Biophys J 70, 296.
Pallitto, MM. et al. (1999). Recognition sequence design for peptidyl modulators of beta-amyloid aggregation and toxicity. Biochem 38, 3570.
Ghanta, J. et al. (1996). A strategy for designing inhibitors of β-amyloid toxicity. J Biol Chem 271, 29525.
     
  < Back