Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Beta-Amyloid (1-40) HCl, Human

Product Name Beta - Amyloid (1 - 40) HCl, Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ? HCl
Size 1 mg
Catalog # 20698
US$ $291
Purity % Peak Area By HPLC ≥ 95%
Description

All the HCl salt forms of A (1-40), A (25-35) and D-Ser26 A (25-35), take the -structure within a few hours in PBS. They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity of non-neuronal (HeLa) cells without cytotoxicity.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Kaneko, I. et al. Nippon Yakurigaku Zasshi. 115, 67 (2000).
Molecular Weight 4329.936.5
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ? HCl
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH ? HCl
Product Citations Kakimura, J-I. et al. FASEB J. 10.1096/fj.01-0530fje (2002).
Kubo, T. et al. Mol. Brain Res. 106, 94 (2002).
Nishimura, S. et al. Pharma. Toxicol. 93, 29 (2003).
Qiao, H. et al. Neurobio. Of Aging 26, 849 (2005).
     
  < Back