Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Scrambled-beta-Amyloid (1-40), Human

Product Name Scrambled - beta - Amyloid (1 - 40), Human
AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Size 0.5 mg
Catalog # AS-24625
US$ $181
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4329.9
Sequence
(One-Letter Code)
AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Sequence
(Three-Letter Code)
H - Ala - Glu - Gly - Asp - Ser - His - Val - Leu - Lys - Glu - Gly - Ala - Tyr - Met - Glu - Ile - Phe - Asp - Val - Gln - Gly - His - Val - Phe - Gly - Gly - Lys - Ile - Phe - Arg - Val - Val - Asp - Leu - Gly - Ser - His - Asn - Val - Ala - OH
Product Citations Ji, Y. et al. J. Alzheimer's Dis. 3, 23 (2001).
     
  < Back