Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Biotin-beta-Amyloid (1-40), Human

Product Name Biotin - beta - Amyloid (1 - 40), Human
Biotin - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 0.1 mg
Catalog # 23512-01
US$ $110
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Storage -20C
References Ref: Saito, Y. et al. Proc. Natl. Acad. Sci. USA 92, 10227 (1995).
Molecular Weight 4556.2
Sequence
(One-Letter Code)
Biotin-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
Biotin - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
Product Citations Paganetti, P. et al. (2014). Increased efflux of amyloid-β peptides through the blood-brain barrier by muscarinic acetylcholine receptor inhibition reduces pathological phenotypes in mouse models of brain amyloidosis. J Alzheimers Dis 38, 767. doi: 10.3233/JAD-131091.
Inaba S. et al. (2005). Specific binding of amyloid-β-protein to IMR-32 neuroblastoma cell membrane. J. Pept. Res. 65, 485.
     
  < Back