Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Beta-Amyloid (1-40)-Lys(Biotin)-NH2, FAM-labeled, Human

Product Name Beta - Amyloid (1 - 40) - Lys(Biotin) - NH2, FAM - labeled, Human
FAM - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - K(Biotin) - NH2
Size 0.1 mg
Catalog # AS-23597-01
US$ $237
Purity % Peak Area By HPLC ≥ 95%
Description

This is a biotinylated (C-terminus) and FAM (carboxyfluorescein, N-terminus)-labeled -Amyloid (1-40), Abs/Em=494/521 nm. FAM is preferred over FITC because of its photo- and chemical stability.

Detailed Information Datasheet
Storage -20C
Molecular Weight 5026.4
Sequence
(One-Letter Code)
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Sequence
(Three-Letter Code)
FAM - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Lys(Biotin) - NH2
     
  < Back