Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Cys-beta-Amyloid (1-40)

Product Name	Cys - beta - Amyloid (1 - 40)
Size	1 mg
Catalog #	23520
US$	$300
Purity	% Peak Area By HPLC ≥ 95%
Detailed Information	Material Safety Data Sheets (MSDS)
Storage	-20°C
References	Ref: Favit, A. et al. J. Neurochem. 75, 1258 (2000).
Molecular Weight	4433
Sequence (One-Letter Code)	CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence (Three-Letter Code)	H - Cys - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH