Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  Scrambled-beta-Amyloid (1-42)

Product Name Scrambled - beta - Amyloid (1 - 42)
Size 0.5 mg
Catalog # 25382
US$ $264
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Storage -20°C
Molecular Weight 4514.1
Sequence
(One-Letter Code)
AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Sequence
(Three-Letter Code)
H - Ala - Ile - Ala - Glu - Gly - Asp - Ser - His - Val - Leu - Lys - Glu - Gly - Ala - Tyr - Met - Glu - Ile - Phe - Asp - Val - Gln - Gly - His - Val - Phe - Gly - Gly - Lys - Ile - Phe - Arg - Val - Val - Asp - Leu - Gly - Ser - His - Asn - Val - Ala - OH
Product Citations Nath, S. et al. (2012). Spreading of neurodegenerative pathology via neuron-to-neuron transmission of β-amyloid. J Neurosci, 32, 8767.
Davis, R. et al. (2011). Amyloid beta dimers/trimers potently induce cofilin-actin rods that are inhibited by maintaining cofilin-phosphorylation. Mol Neurodegeneration 6, 10.
Gamba, P. et al. (2011). Interaction between 24-hydroxycholesterol, oxidative stress and amyloid-β in amplifying neuronal damage in Alzheimer’s disease: three partners in crime. Aging Cell DOI: 10.1111/j.1474-9726.2011.00681.x.
Miners, J. et al. (2011). Neprilysin protects against cerebral amyloid angiopathy and Aβ-induced degeneration of cerebrovascular smooth muscle cells. Brain Pathol DOI: 10.1111/j.1750-3639.2011.00486.x.
Vargas, T. et al. (2010). Gelsolin restores Aβ-induced alterations in choroid plexus epithelium. J Biomed Biotechnol doi:10.1155/2010/805405.
De Felice, FG. et al. (2009). Protection of synapses against Alzheimer’s-linked toxins: Insulin signaling prevents the pathogenic binding of Aβ oligomers. PNAS 106, 1971 (2009).
Garcia-Osta, A. et al. (2009). Amyloid beta mediates memory formation. Learn Mem 16, 267.
Hoos, M. et al. (2009). Myelin basic protein binds to and inhibits the fibrillar assembly of Aβ42 in vitro. Biochem 48, 4720.
Shaked, GM. et al. (2006). Aß induces cell death by direct interaction with its cognate extracellular domain on APP (APP 597–624). FASEB J 20, 1254.
Maloney, MT. et al. (2005). β -secretase-cleaved amyloid precursor protein accumulates at actin inclusions induced in neurons by stress or amyloid β : a feedforward mechanism for Alzheimer’s Disease. J Neurosci 25, 1131.
Puzzo, D. et al. (2005). Amyloid-β peptide inhibits activation of the nitric oxide/cGMP/cAMP-responsive element-binding protein pathway during hippocampal synaptic plasticity. J Neurosci 25, 6887.
Kumar-Singh, S. et al. (2002). In vitro studies of flemish, dutch, and wild-type β-amyloid provide evidence for two-staged neurotoxicity. Neurobio Dis 11, 330.
Lue, LF. And DG. Walker (2002). Modeling Alzheimer's disease immune therapy mechanisms: Interactions of human postmortem microglia with antibody-opsonized amyloid beta peptide. J Neurosci Res 70, 599.
     
  < Back