Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid Peptides - Mouse/Rat  >>  Beta-Amyloid Peptide (1-42), mouse, rat

Product Name Beta - Amyloid Peptide (1 - 42), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Size 1 mg
Catalog # AS-25231
US$ $545
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4418
Sequence
(One-Letter Code)
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Gly - His - Asp - Ser - Gly - Phe - Glu - Val - Arg - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
Product Citations Wyss-Coray, T. et al. (2003). Adult mouse astrocytes degrade amyloid-bold beta in vitro and in situ. Nature Med 9, 453.
Sawamura, N. et al. J. Biol. Chem. 275, 27901 (2000).
     
  < Back