Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-43) to (1-49) and (1-55) Peptides  >>  Beta-Amyloid (1-43), Human

Product Name Beta - Amyloid (1 - 43), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
Size 0.5 mg
Catalog # AS-25356
US$ $335
Purity % Peak Area By HPLC ≥ 95%
Description

Solid A (1-43) fibril is the most fibrillogenic of all the A peptides known.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Ref: George, AR. and DR. Howlett, Biopolymers 50, 733 (1999); Jarrett, JT. et al. Biochem. 32, 4693 (1993).
Molecular Weight 4615.2
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - Thr - OH
     
  < Back