Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  Beta-Amyloid (2-42), Human

Product Name Beta - Amyloid (2 - 42), Human
AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Size 0.1 mg
Catalog # 29909-01
US$ $93
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Storage -20C
References Ref: Wiltfang, J. et al. J. Biol. Chem. 276, 42645 (2001).
Molecular Weight 4399
Sequence
(One-Letter Code)
AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
Product Citations Condic, M. et al. (2014). N-truncation and pyroglutaminylation enhances the opsonizing capacity of Aβ-peptides and facilitates phagocytosis by macrophages and microglia. Brain Behav Immun. doi: 10.1016/j.bbi.2014.05.003.

abortion pill prescription ordering abortion pills to be shipped to house where can i get the abortion pill online

     
  < Back