Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Beta-Amyloid (4-42)

Product Name	Beta - Amyloid (4 - 42)
Size	1 mg
Catalog #	29908-1
US$	$484
Purity	% Peak Area By HPLC ≥ 95%
Detailed Information	Datasheet
Storage	-20°C
References	Ref: Lalowski, M. et al. J. Biol. Chem. 271, 33623 (1996).
Molecular Weight	4198.8
Sequence (One-Letter Code)	FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence (Three-Letter Code)	H - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH