Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  Beta-Amyloid (8-42), Human

Product Name Beta - Amyloid (8 - 42), Human
SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Size 0.1 mg
Catalog # 60085-01
US$ $143
Purity % Peak Area By HPLC ≥ 95%
Description

The degree of amino-terminal truncation varies in different neuritic plaque extractions; however, in studies of several Downs syndrome patients subjected to neuritic plaque extraction, As 1-42, 1-40, 3-42, 4-42, 5-42, 8-42, and 9-42 have been identified.

Storage -20C
References Ref: Lalowski, M. et al. J. Biol. Chem. 271, 33623 (1996).
Molecular Weight 3643.2
Sequence
(One-Letter Code)
SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
Product Citations Solorzano-Vargas, R.S. et al. (2008). Epitope mapping and neuroprotective properties of a human single chain FV antibody that binds an internal epitope of amyloid-beta 1-42. Mol Immunol 45, 881.
     
  < Back