Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Adrenomedullin Peptides  >>  Adrenomedullin (1-50), rat

Product Name Adrenomedullin (1 - 50), rat
YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY - NH2 (Disulfide bridge: 14 - 19)
Size 0.5 mg
Catalog # AS-60454
US$ $335
Purity % Peak Area By HPLC ≥ 95%
Description

Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.

Detailed Information Datasheet
Storage -20C
References Ref: Belloni, AS. et al. Life Sci. 63, 2313 (1998); Sone, M. et al. Peptides 18, 1125 (1997).
Molecular Weight 5729.5
Sequence
(One-Letter Code)
YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
Sequence
(Three-Letter Code)
H - Tyr - Arg - Gln - Ser - Met - Asn - Gln - Gly - Ser - Arg - Ser - Thr - Gly - Cys - Arg - Phe - Gly - Thr - Cys - Thr - Met - Gln - Lys - Leu - Ala - His - Gln - Ile - Tyr - Gln - Phe - Thr - Asp - Lys - Asp - Lys - Asp - Gly - Met - Ala - Pro - Arg - Asn - Lys - Ile - Ser - Pro - Gln - Gly - Tyr - NH2 (Disulfide bridge: 14 - 19)
     
  < Back