Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Agouti Related Peptides  >>  AGRP fragment (83-132), amide

Product Name AGRP fragment (83 - 132), amide
Size 0.1 mg
Catalog # 27124
US$ $457
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is a known endogenous MC3R and MC4R antagonist and a powerful orexigenic peptide when infused centrally. It increases cortisol release and inhibits pulsatile LH release in monkey. AGRP, like NPY, may mediate the effect of a negative energy balance on the reproductive system by suppressing the GnRH pulse generator. AgRP (83-132) significantly increases prolactin mRNA expression level and prolactin accumulation.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref: Vulliemoz, NR. et al. Endocrinol. 146, 784 (2005); Langouche, L. et al. J. Neuroendocrinol. 16, 695 (2004); Yang, Y. et al. Mol. Endocrinol. 13, 148 (1999).
Molecular Weight 5687.7
Sequence
(One-Letter Code)
SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 (5 disulfide bridges)
Sequence
(Three-Letter Code)
H - Ser - Ser - Arg - Arg - Cys - Val - Arg - Leu - His - Glu - Ser - Cys - Leu - Gly - Gln - Gln - Val - Pro - Cys - Cys - Asp - Pro - Cys - Ala - Thr - Cys - Tyr - Cys - Arg - Phe - Phe - Asn - Ala - Phe - Cys - Tyr - Cys - Arg - Lys - Leu - Gly - Thr - Ala - Met - Asn - Pro - Cys - Ser - Arg - Thr - NH2 (5 disulfide bridges; 87 - 102, 94 - 108, 101 - 119, 105 - 129 and 110 - 117).
     
  < Back