Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Growth Hormone Related Peptides  >>  Growth Hormone Releasing Factor, GRF (1-29), amide, human

Product Name Growth Hormone Releasing Factor, GRF (1 - 29), amide, human
Size 0.5 mg
Catalog # 22874
US$ $77
Purity % Peak Area By HPLC ≥ 95%
Description

This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref: Ling, N. et al. Proc. Natl. Acad. Sci. USA 81, 4302 (1984); Gaudreau, P. et al. J. Med. Chem. 35, 1864 (1992); Zarandi, VA. et al. Biochem. Biophys. Res. Commun. 119, 265 (1984); Lapierre, H. et al. Domest. Anim. Endocrinol. 4, 207 (1987); Mayo, KE. et al. Nature 306, 86 (1983); Pinski, J. et al. Peptide Protein Res. 41, 707 (1993).
Molecular Weight 3357.9
Sequence
(One-Letter Code)
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Sequence
(Three-Letter Code)
H - Tyr - Ala - Asp - Ala - Ile - Phe - Thr - Asn - Ser - Tyr - Arg - Lys - Val - Leu - Gly - Gln - Leu - Ser - Ala - Arg - Lys - Leu - Leu - Gln - Asp - Ile - Met - Ser - Arg - NH2
     
  < Back