Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Account Login My Cart My Custom Reports My Favorites Logout
About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Antimicrobial and Related Peptides  >>  Cecropin B
Product Name Cecropin B
Size 0.5 mg
Catalog # 24011
US$ $176
Purity % Peak Area By HPLC ≥ 95%
Description

Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia. Antimicrobial peptides are essential to innate host defense as effectors of pathogen clearance and can affect host cell to promote wound repair.
Detailed Information Datasheet
Storage -20°C
References Ref: Vaara, M. et al. Antimicrob. Agents Chemo. 38, 2498 (1994); Florack, D. et al. Transgenic Res. 4, 132 (1995); Lee, P. et al. Wound Repair Regen. 12, 351 (2004).
Molecular Weight 3834.7
Sequence
(One-Letter Code)		 KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Sequence
(Three-Letter Code)		 H - Lys - Trp - Lys - Val - Phe - Lys - Lys - Ile - Glu - Lys - Met - Gly - Arg - Asn - Ile - Arg - Asn - Gly - Ile - Val - Lys - Ala - Gly - Pro - Ala - Ile - Ala - Val - Leu - Gly - Glu - Ala - Lys - Ala - Leu - NH2
Product Citations Kulagina, NV. et al. Sens Actuators B Chem. 121, 150 (2007).
     
  < Back
Copyright © 2002-2011 AnaSpec, Inc. All rights reserved. | 65.39.186.246 (USA) | Site Map | Terms & Conditions