Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Cecropin B

Product Name	Cecropin B
Size	1 mg
Catalog #	24012
US$	$291
Purity	% Peak Area By HPLC ≥ 95%
Description	Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia. Antimicrobial peptides are essential to innate host defense as effectors of pathogen clearance and can affect host cell to promote wound repair.
Detailed Information	Datasheet
Storage	-20°C
Molecular Weight	3834.7
Sequence (One-Letter Code)	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Product Citations	Kulagina, NV. et al. Sens Actuators B Chem. 121, 150 (2007).