Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  HIV Related Peptides  >>  T20

Product Name T20
Ac - YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF - NH2
Size 1 mg
Catalog # AS-61235
US$ $363
Purity % Peak Area By HPLC ≥ 95%
Description

This 36-residue peptide corresponds to aa 643-678 of the C-terminus of HIV-1LAIgp41. It strongly inhibits HIV-1 viral fusion with an EC50 of 1 ng/ml.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
References Ref: Lawless, MK. et al. Biochem. 35, 13697 (1996); Su, SB. et al. Blood 93, 3885 (1999).
Molecular Weight 4492
Sequence
(One-Letter Code)
Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
Sequence
(Three-Letter Code)
Ac - Tyr - Thr - Ser - Leu - Ile - His - Ser - Leu - Ile - Glu - Glu - Ser - Gln - Asn - Gln - Gln - Glu - Lys - Asn - Glu - Gln - Glu - Leu - Leu - Glu - Leu - Asp - Lys - Trp - Ala - Ser - Leu - Trp - Asn - Trp - Phe - NH2
Product Citations "Lia, PL. et al. (2005). Phosphorylation of HIV Nef by cAMP-dependent protein kinase. Virol 331, 367."
     
  < Back