Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Neuropeptide Y and Analogs  >>  Neuropeptide Y, human, rat

Product Name Neuropeptide Y, human, rat
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY - NH2
Size 1 mg
Catalog # 22465
US$ $181
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
References Ref: Minth, C. et al. Proc. Natl. Acad. Sci. USA 81, 4577 (1984).
Molecular Weight 4271.8
Sequence
(One-Letter Code)
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Sequence
(Three-Letter Code)
H - Tyr - Pro - Ser - Lys - Pro - Asp - Asn - Pro - Gly - Glu - Asp - Ala - Pro - Ala - Glu - Asp - Met - Ala - Arg - Tyr - Tyr - Ser - Ala - Leu - Arg - His - Tyr - Ile - Asn - Leu - Ile - Thr - Arg - Gln - Arg - Tyr - NH2
Product Citations Pelz, KM. & J. Dark Am J Physiol Regulatory Integrative Comp Physiol 292, R2299 (2007).
Gao, J. et al. Am J Physiol Endocrinol Metab 287, E706 (2004).
Kapoor, JR. and CD. Sladek, Am J Physiol Regul Integr Comp Physiol 280, R69 (2001).
     
  < Back