Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Neuropeptide Y and Analogs  >>  Neuropeptide Y, free acid, human, rat

Product Name Neuropeptide Y, free acid, human, rat
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Size 1 mg
Catalog # AS-22467
US$ $181
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Ref: Stanley, BG. et al. Peptides 13, 581 (1992).
Molecular Weight 4272.7
Sequence
(One-Letter Code)
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Sequence
(Three-Letter Code)
H - Tyr - Pro - Ser - Lys - Pro - Asp - Asn - Pro - Gly - Glu - Asp - Ala - Pro - Ala - Glu - Asp - Met - Ala - Arg - Tyr - Tyr - Ser - Ala - Leu - Arg - His - Tyr - Ile - Asn - Leu - Ile - Thr - Arg - Gln - Arg - Tyr - OH
     
  < Back