Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Toxins  >>  Botulinum Neurotoxin (BoNT) B Substrate Modification, amide, FITC-labeled

Product Name Botulinum Neurotoxin (BoNT) B Substrate Modification, amide, FITC - labeled
FITC - LC - LSELDDRADALQAGASQFESSAAKLKRKYWWKNLK - NH2
Size 1 mg
Catalog # 60246-1
US$ $479
Purity % Peak Area By HPLC ≥ 95%
Description

This is a fluorescent (FITC)-labeled botulinum neurotoxin peptide with a BoNT B [Leu 97 (64-98)] substrate peptide modification at Abs/Em=494/520 nm. This peptide is also a modified fragment of the synapatic vesicle-associated membrane protein 1, a nervous-system-specific protein of 120 amino acids.

Storage -20C
References Ref: Trimble, WS. et al. Proc. Natl. Acad. Sci. USA 85, 4538 (1988); Barr, J. et al. Emerg. Inf. Dis. 11, 1578 (2005); Dong, M. et al. J. Cell Biol. 162, 1293 (2003).
Molecular Weight 4516
Sequence
(One-Letter Code)
FITC-LC-LSELDDRADALQAGASQFESSAAKLKRKYWWKNLK-NH2
Sequence
(Three-Letter Code)
FITC - LC - Leu - Ser - Glu - Leu - Asp - Asp - Arg - Ala - Asp - Ala - Leu - Gln - Ala - Gly - Ala - Ser - Gln - Phe - Glu - Ser - Ser - Ala - Ala - Lys - Leu - Lys - Arg - Lys - Tyr - Trp - Trp - Lys - Asn - Leu - Lys - NH2
     
  < Back