Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Stay Logged In

Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Toxins  >>  Charybdotoxin

Product Name Charybdotoxin
Pyr - FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7 - 28, 13 - 33 and 17 - 35)
Size 0.1 mg
Catalog # AS-28244
US$ $171
Purity % Peak Area By HPLC ≥ 95%

Charybdotoxin (ChTX) is a Ca2+-activated K+ channel blocker. It depolarizes peripheral T lymphocytes and blocks their mitogen-induced proliferation. ChTX is a highly basic peptide isolated from venom of the scorpion, Leiurus quinquestriatus hebraeus.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
References Ref: Leonard, R. et al. Proc. Natl. Acad. Sci. USA 89, 10094 (1992); Gimenez-Gallego, Proc. Natl. Acad. Sci. USA 85, 3329 (1988). Sugg, E. et al. J. Biol. Chem. 265, 18745 (1990).
Molecular Weight 4296
(One-Letter Code)
Pyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7-28, 13-33 and 17-35)
(Three-Letter Code)
Pyr - Phe - Thr - Asn - Val - Ser - Cys - Thr - Thr - Ser - Lys - Glu - Cys - Trp - Ser - Val - Cys - Gln - Arg - Leu - His - Asn - Thr - Ser - Arg - Gly - Lys - Cys - Met - Asn - Lys - Lys - Cys - Arg - Cys - Tyr - Ser - OH (Disulfide bridge: 7 - 28, 13 - 33 and 17 - 35)
Product Citations Welschoff, J. et al. (2014). RGD peptides induce relaxation of pulmonary arteries and airways via β3-integrins. FASEB J 28, 2281. doi: 10.1096/fj.13-246348.
Bayram, Z. et al. (2010). The role of nitric oxide and potassium channels in the effect of adrenomedullin in human internal thoracic arteries. Regul Pept 161, 92.
Bayram, Z. et al. (2010). The role of nitric oxide and potassium channels in the effect of adrenomedullin in human internal thoracic arteries. Regul Pept 161, 92.
Bayram, Z. et al. (2010). The role of nitric oxide and potassium channels in the effect of adrenomedullin in human internal thoracic arteries. Regul Pept 161, 92.
Sankaralingam, S. et al. (2008). Chronic clofibrate administration prevents salineinduced endothelial dysfunction and oxidative stress in young Sprague-Dawley rats. Clin Invest Med 31, e62.
Desai, KM. et al. (2006). EDHF-mediated rapid restoration of hypotensive response to acetylcholine after chronic, but not acute, nitric oxide synthase inhibition in rats. Eur J Pharmacol 546, 120.
Bayram, Z. et al. (2010). The role of nitric oxide and potassium channels in the effect of adrenomedullin in human internal thoracic arteries. Regul Pept 161, 92.
Bayram, Z. et al. (2010). The role of nitric oxide and potassium channels in the effect of adrenomedullin in human internal thoracic arteries. Regul Pept 161, 92.
Bayram, Z. et al. (2010). The role of nitric oxide and potassium channels in the effect of adrenomedullin in human internal thoracic arteries. Regul Pept 161, 92.
  < Back