Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Toxins  >>  Charybdotoxin

Product Name Charybdotoxin
Pyr - FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7 - 28, 13 - 33 and 17 - 35)
Size 0.1 mg
Catalog # 28244
US$ $171
Purity % Peak Area By HPLC ≥ 95%
Description

Charybdotoxin (ChTX) is a Ca2+-activated K+ channel blocker. It depolarizes peripheral T lymphocytes and blocks their mitogen-induced proliferation. ChTX is a highly basic peptide isolated from venom of the scorpion, Leiurus quinquestriatus hebraeus.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
References Ref: Leonard, R. et al. Proc. Natl. Acad. Sci. USA 89, 10094 (1992); Gimenez-Gallego, Proc. Natl. Acad. Sci. USA 85, 3329 (1988). Sugg, E. et al. J. Biol. Chem. 265, 18745 (1990).
Molecular Weight 4296
Sequence
(One-Letter Code)
Pyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7-28, 13-33 and 17-35)
Sequence
(Three-Letter Code)
Pyr - Phe - Thr - Asn - Val - Ser - Cys - Thr - Thr - Ser - Lys - Glu - Cys - Trp - Ser - Val - Cys - Gln - Arg - Leu - His - Asn - Thr - Ser - Arg - Gly - Lys - Cys - Met - Asn - Lys - Lys - Cys - Arg - Cys - Tyr - Ser - OH (Disulfide bridge: 7 - 28, 13 - 33 and 17 - 35)
Product Citations Welschoff, J. et al. (2014). RGD peptides induce relaxation of pulmonary arteries and airways via β3-integrins. FASEB J 28, 2281. doi: 10.1096/fj.13-246348.
Cho, Y-E. et al. (2013). Coronary endothelial dysfunction and mitochondrial reactive oxygen species in type 2 diabetic mice. Am J Physiol-Cell Physiol 305 C1033. doi: 10.1152/ajpcell.00234.2013.
Stoneking, CJ. et al. (2013). Voltage dependence of the Ca2+-activated K+ channel KCa3. 1 in human erythroleukemia cells. Am J Physiol-Cell Physiol 304 C858. doi: 10.1152/ajpcell.00368.2012.
Bayram, Z. et al. (2010). The role of nitric oxide and potassium channels in the effect of adrenomedullin in human internal thoracic arteries. Regul Pept 161, 92.
Sankaralingam, S. et al. (2008). Chronic clofibrate administration prevents salineinduced endothelial dysfunction and oxidative stress in young Sprague-Dawley rats. Clin Invest Med 31, e62.
Desai, KM. et al. (2006). EDHF-mediated rapid restoration of hypotensive response to acetylcholine after chronic, but not acute, nitric oxide synthase inhibition in rats. Eur J Pharmacol 546, 120.
Nemargut, JP., et al. (2009). Differential effects of charybdotoxin on the activity of retinal ganglion cells in the dark-and light-adapted mouse retina. Vision Res 49, 388. doi: 10.1016/j.visres.2008.11.008.
Bingham, J-P. et al. (2006). Synthesis of a biotin derivative of iberiotoxin: binding interactions with streptavidin and the BK Ca2+-activated K+ channel expressed in a human cell line. Bioconjugate Chem 17, 689. doi: 10.1021/bc060002u.
Sankaralingam, S. et al. (2006). Clofibrate acutely reverses saline-induced endothelial dysfunction: Role of calcium-activated potassium vhannels. Am J Hypertension 19, 1167. doi: 10.1016/j.amjhyper.2006.04.005.
     
  < Back