Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Toxins  >>  [Glu32]-Charybdotoxin

Product Name [Glu32] - Charybdotoxin
Pyr - FTNVSCTTSKECWSVCQRLHNTSRGKCMNKECRCYS (Disulfide bridge: 7 - 28, 13 - 33 and 17 - 35)
Size 0.1 mg
Catalog # AS-61200-01
US$ $143
Purity % Peak Area By HPLC ≥ 95%
Storage -20C
Molecular Weight 4296.9
Sequence
(One-Letter Code)
Pyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKECRCYS (Disulfide bridge: 7-28, 13-33 and 17-35)
Sequence
(Three-Letter Code)
Pyr - Phe - Thr - Asn - Val - Ser - Cys - Thr - Thr - Ser - Lys - Glu - Cys - Trp - Ser - Val - Cys - Gln - Arg - Leu - His - Asn - Thr - Ser - Arg - Gly - Lys - Cys - Met - Asn - Lys - Glu - Cys - Arg - Cys - Tyr - Ser - OH (Disulfide bridge: 7 - 28, 13 - 33 and 17 - 35)
     
  < Back