Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Account Login My Cart My Custom Reports My Favorites Logout
About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Toxins  >>  Chlorotoxin (Cltx) 
Product Name Chlorotoxin (Cltx) 
Size 0.1 mg
Catalog # 60770
US$ $115
Purity % Peak Area By HPLC ≥ 95%
Description

A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref: DeBin, JA. and GR. Strichartz, Toxicon 29, 1403 (1991); DeBin, JA. et al. Am. J. Physiol. 264, C361 (1993).
Molecular Weight 3996
Sequence
(One-Letter Code)		 MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
Sequence
(Three-Letter Code)		 H - Met - Cys - Met - Pro - Cys - Phe - Thr - Thr - Asp - His - Gln - Met - Ala - Arg - Lys - Cys - Asp - Asp - Cys - Cys - Gly - Gly - Lys - Gly - Arg - Gly - Lys - Cys - Tyr - Gly - Pro - Gln - Cys - Leu - Cys - Arg - NH2 (Disulfide bridge: 2 - 19,5 - 28,16 - 33,20 - 35)
Product Citations Meng, X. et al. Acta Pharmacol. Sinica 28, 2019 (2006).
Wan, J. et al. (2010). Incorporation of magnetite nanoparticle clusters in fluorescent silica nanoparticles for high-performance brain tumor delineation. Nanotechnololgy 21, 235104.
     
  < Back
Copyright © 2002-2011 AnaSpec, Inc. All rights reserved. | 65.39.186.246 (USA) | Site Map | Terms & Conditions