Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Stay Logged In

Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Toxins  >>  Chlorotoxin (Cltx)

Product Name Chlorotoxin (Cltx)
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR - NH2 (Disulfide bridge: 2 - 19,5 - 28,16 - 33,20 - 35)
Size 0.1 mg
Catalog # 60770
US$ $115
Purity % Peak Area By HPLC ≥ 95%

A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
References Ref: DeBin, JA. and GR. Strichartz, Toxicon 29, 1403 (1991); DeBin, JA. et al. Am. J. Physiol. 264, C361 (1993).
Molecular Weight 3996
(One-Letter Code)
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
(Three-Letter Code)
H - Met - Cys - Met - Pro - Cys - Phe - Thr - Thr - Asp - His - Gln - Met - Ala - Arg - Lys - Cys - Asp - Asp - Cys - Cys - Gly - Gly - Lys - Gly - Arg - Gly - Lys - Cys - Tyr - Gly - Pro - Gln - Cys - Leu - Cys - Arg - NH2 (Disulfide bridge: 2 - 19,5 - 28,16 - 33,20 - 35)
Product Citations Meng, X. et al. Acta Pharmacol. Sinica 28, 2019 (2006).
Wan, J. et al. (2010). Incorporation of magnetite nanoparticle clusters in fluorescent silica nanoparticles for high-performance brain tumor delineation. Nanotechnololgy 21, 235104.
  < Back