Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Vasoactive Intestinal Peptides (VIPs)  >>  VIP, human, porcine, rat

Product Name VIP, human, porcine, rat
HSDAVFTDNYTRLRKQMAVKKYLNSILN - NH2
Size 1 mg
Catalog # 22873
US$ $121
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Storage -20C
References Ref: Paul, S. et al. J. Biol. Chem. 276, 28314 (2001).
Molecular Weight 3325.9
Sequence
(One-Letter Code)
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Sequence
(Three-Letter Code)
H - His - Ser - Asp - Ala - Val - Phe - Thr - Asp - Asn - Tyr - Thr - Arg - Leu - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Asn - Ser - Ile - Leu - Asn - NH2
     
  < Back