Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Vasoactive Intestinal Peptides (VIPs)  >>  VIP Antagonist

Product Name VIP Antagonist
KPRRPYTDNYTRLRKQMAVKKYLNSILN - NH2
Size 0.5 mg
Catalog # 24218
US$ $121
Purity % Peak Area By HPLC ≥ 95%
Description

A hybrid peptide of neurotensin and VIP consisting of N-terminal Lys-Pro-Arg-Arg-Pro-Tyr folllowed by 7 -28 residues VIP.

Storage -20C
Molecular Weight 3467.1
Sequence
(One-Letter Code)
KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2
Sequence
(Three-Letter Code)
H - Lys - Pro - Arg - Arg - Pro - Tyr - Thr - Asp - Asn - Tyr - Thr - Arg - Leu - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Asn - Ser - Ile - Leu - Asn - NH2
     
  < Back