Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Pancreatic Polypeptides  >>  Pancreastatin, porcine

Product Name Pancreastatin, porcine
Size 1 mg
Catalog # 60752-1
US$ $445
Purity % Peak Area By HPLC ≥ 95%
Description

Pancreastatin (PST), originally isolated from porcine pancreas, is a 49-amino acid peptide with a C-terminal glycine amide. PST and chromostatin are chromogranin A (CGA)-derived peptides. PST has a general inhibitory effect on secretion in many exocrine and endocrine systems. It has been associated with a glucose and lipid metabolism in the liver and adipose tissue.

Storage -20°C
References Ref: Gonzalez-Yanes, K. et al. Cell Signal. 13, 43 (2001); Santos-Alvarez et al. Arch. Biochem. Biophys. 378, 151 (2000); Jensen, T. et al. Scand J. Gastroenterol. 29, 376 (1994); Ahren, B. Eur. J. Pharmacol. 126, 97 (1986).
Molecular Weight 5103.5
Sequence
(One-Letter Code)
GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2
Sequence
(Three-Letter Code)
H - Gly - Trp - Pro - Gln - Ala - Pro - Ala - Met - Asp - Gly - Ala - Gly - Lys - Thr - Gly - Ala - Glu - Glu - Ala - Gln - Pro - Pro - Glu - Gly - Lys - Gly - Ala - Arg - Glu - His - Ser - Arg - Gln - Glu - Glu - Glu - Glu - Glu - Thr - Ala - Gly - Ala - Pro - Gln - Gly - Leu - Phe - Arg - Gly - NH2
     
  < Back