Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Parathyroid Hormones and Related Peptides  >>  Parathyroid Hormone (1-34), human

Product Name Parathyroid Hormone (1 - 34), human
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Size 1 mg
Catalog # AS-20708
US$ $171
Purity % Peak Area By HPLC ≥ 95%
Description

Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(134) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
References Ref: Shao, J. et al. J. Biol. Chem. 278, 50195 (2003); Shew, RL. and PKT. Pang Peptides 5, 485 (1984).
Molecular Weight 4117.8
Sequence
(One-Letter Code)
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Sequence
(Three-Letter Code)
H - Ser - Val - Ser - Glu - Ile - Gln - Leu - Met - His - Asn - Leu - Gly - Lys - His - Leu - Asn - Ser - Met - Glu - Arg - Val - Glu - Trp - Leu - Arg - Lys - Lys - Leu - Gln - Asp - Val - His - Asn - Phe - OH
Product Citations Hoare, S. R. J. et al. J. Biol. Chem. 276, 7741 (2001).
Liu, G. et al. J. Biol. Chem. 282, 20407 (2007).
     
  < Back