Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Parathyroid Hormones and Related Peptides  >>  TIP 39, Tuberoinfundibular Neuropeptide

Product Name TIP 39, Tuberoinfundibular Neuropeptide
Size 1 mg
Catalog # 21687
US$ $423
Purity % Peak Area By HPLC ≥ 95%
Description

This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref: Usdin, TB. et al. Nat. Am. 2, 941 (1999); Piserchio, A. et al. J. Biol. Chem. 275, 27284 (2000).
Molecular Weight 4504.3
Sequence
(One-Letter Code)
SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Sequence
(Three-Letter Code)
H - Ser - Leu - Ala - Leu - Ala - Asp - Asp - Ala - Ala - Phe - Arg - Glu - Arg - Ala - Arg - Leu - Leu - Ala - Ala - Leu - Glu - Arg - Arg - His - Trp - Leu - Asn - Ser - Tyr - Met - His - Lys - Leu - Leu - Val - Leu - Asp - Ala - Pro - OH
Product Citations Panda, D. et al. (2009). TIP39/Parathyroid Hormone Type 2 Receptor Signaling is a Potent Inhibitor of Chondrocyte Proliferation and Differentiation. Am J Physiol Endocrinol Metab 10.
Barker, T. H. et al. (2004). Thrombospondin-1-induced Focal Adhesion Disassembly in Fibroblasts Requires Thy-1 Surface Expression, Lipid Raft Integrity, and Src Activation. J Biol Chem 279, 23510.
Bisello, Alessandro. et al. (2004). Agonist-Specific Regulation of Parathyroid Hormone (PTH) Receptor Type 2 Activity: Structural and Functional Analysis of PTH- and Tuberoinfundibular Peptide (TIP) 39-Stimulated Desensitization and Internalization. Mol Endocrinology 18, 1486.
Sugimura, Y. et al. (2003). Centrally Administered Tuberoinfundibular Peptide of 39 Residues Inhibits Arginine Vasopressin Release in Conscious Rats. Endocrinology 144, 2791.
Hoare, S. R. J. et al. (2001). Evaluating the Signal Transduction Mechanism of the Parathyroid Hormone 1 Receptor. J Biol Chem 276, 7741.
Piserchio, A. et al. (2000). Structure of Tuberoinfundibular Peptide of 39 Residues. J Biol Chem 275, 27284.
Hoare, S. R. J. et al. (2000). Molecular Determinants of Tuberoinfundibular Peptide of 39 Residues (TIP39) Selectivity for the Parathyroid Hormone-2 (PTH2) Receptor. J Biol Chem 275, 27274.
     
  < Back