Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Parathyroid Hormones and Related Peptides  >>  Parathyroid Hormone (1-34), human, biotinylated

Product Name Parathyroid Hormone (1 - 34), human, biotinylated
Biotin - SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Size 1 mg
Catalog # 20690
US$ $291
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4344.1
Sequence
(One-Letter Code)
Biotin-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Sequence
(Three-Letter Code)
Biotin - Ser - Val - Ser - Glu - Ile - Gln - Leu - Met - His - Asn - Leu - Gly - Lys - His - Leu - Asn - Ser - Met - Glu - Arg - Val - Glu - Trp - Leu - Arg - Lys - Lys - Leu - Gln - Asp - Val - His - Asn - Phe - OH
     
  < Back