Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Parathyroid Hormones and Related Peptides  >>  Parathyroid Hormone (1-34), human, FAM-labeled

Product Name Parathyroid Hormone (1 - 34), human, FAM - labeled
FAM - SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Size 1 mg
Catalog # AS-23617
US$ $545
Purity % Peak Area By HPLC ≥ 95%
Description

This is a fluorescent (FAM)-labeled PTH peptide, Abs/Em=492/518 nm.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4476.1
Sequence
(One-Letter Code)
FAM-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Sequence
(Three-Letter Code)
FAM - Ser - Val - Ser - Glu - Ile - Gln - Leu - Met - His - Asn - Leu - Gly - Lys - His - Leu - Asn - Ser - Met - Glu - Arg - Val - Glu - Trp - Leu - Arg - Lys - Lys - Leu - Gln - Asp - Val - His - Asn - Phe - OH
     
  < Back