Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Parathyroid Hormone (1-34), human, FAM-labeled

Product Name	Parathyroid Hormone (1 - 34), human, FAM - labeled
Size	1 mg
Catalog #	23617
US$	$545
Purity	% Peak Area By HPLC ≥ 95%
Description	This is a fluorescent (FAM)-labeled PTH peptide, Abs/Em=492/518 nm.
Detailed Information	Material Safety Data Sheets (MSDS)
Storage	-20°C
Molecular Weight	4476.1
Sequence (One-Letter Code)	FAM-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Sequence (Three-Letter Code)	FAM - Ser - Val - Ser - Glu - Ile - Gln - Leu - Met - His - Asn - Leu - Gly - Lys - His - Leu - Asn - Ser - Met - Glu - Arg - Val - Glu - Trp - Leu - Arg - Lys - Lys - Leu - Gln - Asp - Val - His - Asn - Phe - OH