PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.
Ref: Tatemoto, K. et al. BBRC 157, 713 (1988); Halldén, G. and G. Aponte, J. Biol. Chem. 272, 12591 (1997); Murphy, KG. and SR. Bloom, Exp. Physiol. 89, 507 (2004); Batterham, R. et al. Nature 418, 650 (2002); Gribble, F. et al. Diabetes 52,1147 (2003); Batterham, R. et al. N. Engl. J. Med. 349, 941 (2003).
Molecular Weight
4309.8
Sequence (One-Letter Code)
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Sequence (Three-Letter Code)
H - Tyr - Pro - Ile - Lys - Pro - Glu - Ala - Pro - Gly - Glu - Asp - Ala - Ser - Pro - Glu - Glu - Leu - Asn - Arg - Tyr - Tyr - Ala - Ser - Leu - Arg - His - Tyr - Leu - Asn - Leu - Val - Thr - Arg - Gln - Arg - Tyr - NH2