Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Peptide YY and Analogs  >>  Peptide YY, human

Product Name Peptide YY, human
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY - NH2
Size 1 mg
Catalog # AS-24402
US$ $253
Purity % Peak Area By HPLC ≥ 95%
Description

PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.

Detailed Information Datasheet
Storage -20°C
References Ref: Tatemoto, K. et al. BBRC 157, 713 (1988); Halldén, G. and G. Aponte, J. Biol. Chem. 272, 12591 (1997); Murphy, KG. and SR. Bloom, Exp. Physiol. 89, 507 (2004); Batterham, R. et al. Nature 418, 650 (2002); Gribble, F. et al. Diabetes 52,1147 (2003); Batterham, R. et al. N. Engl. J. Med. 349, 941 (2003).
Molecular Weight 4309.8
Sequence
(One-Letter Code)
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Sequence
(Three-Letter Code)
H - Tyr - Pro - Ile - Lys - Pro - Glu - Ala - Pro - Gly - Glu - Asp - Ala - Ser - Pro - Glu - Glu - Leu - Asn - Arg - Tyr - Tyr - Ala - Ser - Leu - Arg - His - Tyr - Leu - Asn - Leu - Val - Thr - Arg - Gln - Arg - Tyr - NH2
     
  < Back