Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Peptide YY and Analogs  >>  Peptide YY (3-36), human

Product Name Peptide YY (3 - 36), human
Size 0.5 mg
Catalog # 24405
US$ $143
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide, a PYY (3-36), a Y2R agonist, is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal and can inhibit food intake.

Detailed Information Datasheet
Storage -20°C
References Ref: Grandt, D. et al. Regul. Peptides 40, 161 (1992); Batterham, R. et al. Nature. 418, 650 (2002).
Molecular Weight 4049.5
Sequence
(One-Letter Code)
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Sequence
(Three-Letter Code)
H - Ile - Lys - Pro - Glu - Ala - Pro - Gly - Glu - Asp - Ala - Ser - Pro - Glu - Glu - Leu - Asn - Arg - Tyr - Tyr - Ala - Ser - Leu - Arg - His - Tyr - Leu - Asn - Leu - Val - Thr - Arg - Gln - Arg - Tyr - NH2
Product Citations Adams, Sean H. et al. Endocrinology. 145, 4967 (2004).
     
  < Back