Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Pituitary Adenylate Cyclase Activating Peptides (PACAPS)  >>  PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat

Product Name PACAP (1 - 38) - Lys(Biotin), amide, human, ovine, rat
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin) - NH2
Size 0.5 mg
Catalog # 23648
US$ $401
Purity % Peak Area By HPLC ≥ 95%
Storage -20C
Molecular Weight 4888.8
Sequence
(One-Letter Code)
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
Sequence
(Three-Letter Code)
H - His - Ser - Asp - Gly - Ile - Phe - Thr - Asp - Ser - Tyr - Ser - Arg - Tyr - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Ala - Ala - Val - Leu - Gly - Lys - Arg - Tyr - Lys - Gln - Arg - Val - Lys - Asn - Lys - Lys(Biotin) - NH2
     
  < Back