Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Pituitary Adenylate Cyclase Activating Peptides (PACAPS)  >>  PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat

Product Name PACAP (1 - 38) - Lys(Biotin), amide, human, ovine, rat
Size 0.5 mg
Catalog # 23648
US$ $401
Purity % Peak Area By HPLC ≥ 95%
Storage -20°C
Molecular Weight 4888.8
Sequence
(One-Letter Code)
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
Sequence
(Three-Letter Code)
H - His - Ser - Asp - Gly - Ile - Phe - Thr - Asp - Ser - Tyr - Ser - Arg - Tyr - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Ala - Ala - Val - Leu - Gly - Lys - Arg - Tyr - Lys - Gln - Arg - Val - Lys - Asn - Lys - Lys(Biotin) - NH2
     
  < Back