This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.
Storage
-20°C
References
Ref: Robberecht, P. et al. Eur. J. Biochem. 207, 239 (1992).
Molecular Weight
4024.8
Sequence (One-Letter Code)
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Sequence (Three-Letter Code)
H - Phe - Thr - Asp - Ser - Tyr - Ser - Arg - Tyr - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Ala - Ala - Val - Leu - Gly - Lys - Arg - Tyr - Lys - Gln - Arg - Val - Lys - Asn - Lys - NH2
