Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Calcitonin Related Peptides  >>  Calcitonin, human

Product Name Calcitonin, human
Size 5 mg
Catalog # 20674
US$ $577
Purity % Peak Area By HPLC ≥ 95%
Description

Human calcitonin stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Pagetˇ¦s disease.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref: Raddino, R. et al. J. Cardiovas. Pharmacol. 29, 463 (1997); Rotella, C. et al. Eur. J. Pharmacol. 107, 347 (1985); Moriarty, et al. Biochem Biophys Res. Commun. 245, 344 (1998); Chen, W. et al. Mol. Pharmacol. 52, 1164 (1997).
Molecular Weight 3417.9
Sequence
(One-Letter Code)
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
Sequence
(Three-Letter Code)
H - Cys - Gly - Asn - Leu - Ser - Thr - Cys - Met - Leu - Gly - Thr - Tyr - Thr - Gln - Asp - Phe - Asn - Lys - Phe - His - Thr - Phe - Pro - Gln - Thr - Ala - Ile - Gly - Val - Gly - Ala - Pro - NH2 (Disulfide bridge: 1 - 7)
Product Citations Takiyama, K. et al. (2009). A Phos-tag-based fluorescence resonance energy transfer system for the analysis of the dephosphorylation of phosphopeptides. Anal Biochem 388, 235.
     
  < Back