Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Calcitonin Related Peptides  >>  Biotin-Calcitonin, human

Product Name Biotin - Calcitonin, human
Biotin - CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7)
Size 0.5 mg
Catalog # 23580
US$ $303
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 3644.2
Sequence
(One-Letter Code)
Biotin-CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
Sequence
(Three-Letter Code)
Biotin - Cys - Gly - Asn - Leu - Ser - Thr - Cys - Met - Leu - Gly - Thr - Tyr - Thr - Gln - Asp - Phe - Asn - Lys - Phe - His - Thr - Phe - Pro - Gln - Thr - Ala - Ile - Gly - Val - Gly - Ala - Pro - NH2 (Disulfide bridge: 1 - 7)
Product Citations Bassim, C.W. et al. (2008). Salivary procalcitonin and periodontitis in diabetes. J. Dental Res. 87, 630.
     
  < Back