Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  CART (Cocaine- and Amphetamine-Regulated Transcript) Peptides  >>  CART (55-102), human

Product Name CART (55 - 102), human
VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge: 74 - 94, 68 - 86, and 88 - 101)
Size 0.1 mg
Catalog # AS-24154
US$ $457
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is a food-intake inhibitor.

Storage -20C
Molecular Weight 5245.2
Sequence
(One-Letter Code)
VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge: 74-94, 68-86, and 88-101)
Sequence
(Three-Letter Code)
H - Val - Pro - Ile - Tyr - Glu - Lys - Lys - Tyr - Gly - Gln - Val - Pro - Met - Cys - Asp - Ala - Gly - Glu - Gln - Cys - Ala - Val - Arg - Lys - Gly - Ala - Arg - Ile - Gly - Lys - Leu - Cys - Asp - Cys - Pro - Arg - Gly - Thr - Ser - Cys - Asn - Ser - Phe - Leu - Leu - Lys - Cys - Leu - OH (Disulfide bridge: 74 - 94, 68 - 86, and 88 - 101)
     
  < Back